(Il i I .-- '. ' '. ,*4;." :1 * . j, - ../ ' .O,- r .' v -•.-.- 'rr i , ti I' 7' • ' _.. :. 4,16/,..: . ,. .& / ' . --. ittivelvd - .';."'rerg•Ktiilg,al-o,t/..ear,a/ro, montaxslulia al, /ft ; ear vo- ^‘ , 1114 11 , *.• .- • I cocoa "ktn- The mans by tbe vender it renown new yorr i on Wird We ere linttother colunineoplous nattiest; 1 41 : 4104 / 1 11 " "° ' :bent b fitiretietir tGd ' tiifaitia tif ?web edertikiattlkho6iliti*9AlASErirrf went is noir gavolebtidtiCitiiillyibetrititento nadir of her °Motets:Want fifigehefilSottolle received off Op Ittsei,berelY-oontaillailArkancz nouncemettiatirlenanf4cf tritish4lovern-t Mint wank fitr ,Illont)O,lhocklstilht..thafta, POPOoDol o r '' C rest It is off 14; alteribfiltiradeligb; the eldef4kolateightlit`tr-Vapitof - -eafeacion,int Wasiilusttipteliaraientill:ie rltdfts - Mt d , *nt. ttelohifk t; • A hanklnginlab i tion,oalleiCtltea.n.n Vanbil recently debt - at ilaitantot*oOlaillor on Ehitur'! day, and its eirnolatit t + f it : W T trill_4l - iketi r tie, The .1 1 444te - Oa* Ealliclia.tsetlfen , f ork ; found the, griscrierigtdity Aflnturday In the bet degree. 'Phrit SWUM ketart**Sili4 , l l :rial the deibudjg*CeNtßOM ;jig): ordered, and the jury'alts iMattolas .- ..eision may .iletAna/ibutottuaGtoyeanbralltoloh ttl decide that it shall staxlateo;4r,-`s , afr-ra't'l. On Saturday, in 442 - tott_Ca r n fl iti u t e t junotionnsited bfooreliff-hindertaMnp6finon - of the Onion Canal ,contgic-tobstrain-the,,lat ter from dlegsVed` Rik tko , )qtriekolOffibii-' rest on thaifdiapoitlANyrjis In the'oCii* JVAtion-77cii.n4dahi Robert lk. , Parrisit.andrvtheffivra reatradiwialnecE Page and othengAnnii_i*ef the stook CriblZtitiaig*tro if a family qu'aiia. l A ,akeiat. lksAff. p es in 6e Board of OommisetothirtWnglike , iinirt -ordered liia special injunction , inicoiding7to. (he. ayer-sof - petitioners; it beini=tinderiteaditiiii the' a:unsafe signers aro to adjourn tha taking ofcsubsoriptienii, until An aPPI,q4(44-7,048-?4444/094:-.0,e, sumo court, askingforapeedititijneetiabixestrainbe Second itud-Thirltatrobt - tßiffitbefloOleaken - Y'fritht refusing tirtalft the etiia:j6f . 0001'n'theonandilolt lets offered to the dininicsip:neiCAO4dripifort , for twoutylix burcitAilui:ref 4,lhOefehtlaKoOkofd said oompCny, ThaconrOdterficurbg arguaents„, adjourned .thentise till, next Saturday. In the Court of Uomoon.Ploaa, Tudgeffhompsen - refused ehaibre fs:' charter asked leteAkti_ildaffe,itett In the Pert Anarterz.Randenam'lScilirday,: sentence cipa.pronottgoed erpoti lienryllifiller, the' witness conviotekof--perjury'ifi , the ? eelebrated Apple oase:=llhe tp ih Rietein penitentiaW4eArtii 40044.04041143.,' The hot nattier irthe lad week:toile' largely upon the lIPPI9Egf .olg4tl,,r# l * - :d Tha .-Itatff• meat of theimPobe.riOS lotertamktraers-tho l linelo ending Sattirdo-reachertioNnal.of. 213 an inr; crease of 2i-tioli; a iirOvits,vedeifersibice:an - of 43 oveOliat of Alto st h'., WHAT OF PENNSTIVANOI Tho hog gl.preperstipn tofr:thO Qctober election, though notyet mid4runnier, lialyeridy heard in 'erefYiliiiigreisienef ,:diStriCe - t;ip,;this State. Thle i betokernsartantniated and s ..c/Ci,- ; ; ting campalgw., Everphourlyill,i444 tsr, the. intensity Of the struggle, , ,end estkirtiAtft.taXei by tfrsie !neon seense . to be taken WAlkti , iliii4ct...view to hicreaSeilthei. bitterheirewhiet seiisidely prevails. The fatiAtt firityfeOe upon the re.sVar-ImiLlia,4.:if, gff. party in Wiagieeinili#ed,atdAtimaiate.oy,fhef office-holders-ferthe Federal Glivernment,ludeet bun dimly/guru tAat „ ers , erythistgis,:te give way to lefioinkift#,.. In the midst . ofltherCryAfor,ticork_cille,tihn the work of proscription goes on. Even while thousandropottionsittiJOieSeittli*eitkl mending that itiia Primeziritien should cease. and in the midst of certain 2offers.of -compro: - miss from .Wasbingtott itself,the guillotine is. kept at itelgosil.7lSirkq"mati office nnltsis:l44 1411647104*Acesli sacrifice ev"oriti . dutltordieliompton. Ever) man is eie . :Cfslif effect whielsliiiiiii;i*el4l, l ,lllYrrielir< ring events is natural alikgersersdiq. In Peii04,1(4104#44:00 ,1 1'5 - v; , lii':af this day a' sPiTiCe:f f Atelelidi;reeistininiaelibis proscriptive•=polleyk , 7ltt . isiUlyr:Cgriistenat , district ate.,),:fetTs?, rkin moat, if set alt-theseidistrictuthey will fear. logy rekuke:fi.resumli - or the field ailkion SS''''siierOliectiatthefaotti;sn: THE vezvmsirmr.alat RA.TLitop. Wbile*if4 NE_ Lic44 1 4 11 4i04 1 4 . the conntryarilsoargutaingotditionvik , Pennsylvapliit his'itoefett *pin 9k. - depression i?r,:".diiirikeeltAipitetinigritilOind the reportiof4ts ttrattle74for4thelaii , month reveals thji*Z;4 4 iYMArOmi, upon the o;n:respoidltitiglincorlast , ,yeark, Tho gross •earningi fete Men:1868; hive bebn• 5480,470.92, 7141eA L T Alloy„"Vfirc s4os,6sB.olo4lMirlngrair.hiproitementasifm6 venue of zieirly 470,090 EhieliOtribil', sitter rate for" tfie : i4itiiiiie'Cilikte"yeite make an additlettAif 4iiioomn;ofsnear); By the prnoie.lat action ot ; tors, last failialßiniimitictirlimodetarydif4' ileulty, a laiggrOdi , fet( li 14 40s 6and in the 100314,3Kolipali enaoYoilo and by this poßera decided 'Buffington the running e 4 .0t440,f4.4: Thus In thit.: l 442MonVltYPPWithEaudlDE tht much ; ea scarcely aeario 3 l l ,9Wiger3ri It 10,, in . fact; iconomp of , Oritlapthar the presentypijaKtlßEllSariChil the companalriteWifeAgpainlY due: .; The gross returns for the five menthe from lan. Ist, te)'Utib:lac4Kl4loloo,),l.el-6i, those for the..44PPPolag mn 4o4 aaaYear,i! i the actual decreaserbeitliftetsB;B:o,B4:ZMic diminution iftkiitieslitiltig,4l4 .' i tutriie:. time for 1858, is Over.'nee :hundred -amt sixty-three ',,, thousand dolart;s:' -,„;1-,r -.;.'` <..,._,, :- Such remiltittelitOm:reflect credit upon the managemeneef - thmCentratßoad,-and' - afford gratifYing proof that "our greatinlek,Or e s c . ,:ni's municationifith iliOnteriet is fillif ; life mid. energy. ThepredictionstoriginallY madc'hy , its enthusitudiefrlends:hrehivjlioift AO' realized, for itlitirixibbi eißiefa.mport:thci bn , „ sinew interestieenhe: , frcittliate 4 beeiPliteif greater tha n 'he *lief imgi,n47 4 directness officette,, its sdvatitagdortialgindei compared with those of , ils .rivals, its pi= roughly anb:stlistkOntg44fo,ric.fathirAnti-f. ribly systonvoilteightageeniagurated* the present minkieidenti litivelitilirshaired a lucrative and , ateedily.Jn ppai trade. , The• receipts not -Only ifiereatra 4 ,glei' tint . alse Westward, attr!*thiid i :ec ejtsloif:iiMeiltii,* show by a comparbionogelbe receiPtaritern emigrant treitikAltelrfe•thOilvientl:sfsiZen:: This item q--xl_6-lii#o.olX.O.Mlikalinlino. the coming summeriattauropeturmmigrante are only beginning to learn -the - manifest ad. vantages, iellidint-`:ercipeeif irnir Coinfoit, 'id the Penniryfittillk - keite - f 2 :`,Alibetigh "'Sliding of the city of, ,tfeivycitiO,.W,ill4l - ',:ba'ista - of its gi Erie," as Wetlat4teu use,4tted.l4ceri* , .,' mites to the West, these strangers from ether lands Preibr teSt*.frPla#lJi PPlat, l 99ntheit Western journey. , ~ .Thtylltaveilit :least,..the . certainty heir - of lint' itliik itkised upop by the race et: iiiiirsW., Jpoictit'Ylifilio44:ok . thaw like a phtgliepanilleborbttedpimPletely ruin the nisMireWviethhilit po i ttiiiti. nate enoughlefill,friaAerc,,hafeje,, ~ ~ .:. The Pennsylvania Railroadvare Inc** . their acconigtAtiohNraoik:***** mentation of Itraiig iitaiate enow 4tookihg, their road ItlikAie* " 4 rOrdlei*rtekilZff4 emigrant tral, Pits ' 4diTrh re rli a le*lnikerier ' to' any nowin Use ircthetetintryvi:Xithett c ym mt , other routee;..tlik.§.4oo 014s 0 hi gi,ina:nt gers bound ttrill ' Er.liesfitled,:bailittert - subort dinatedl6 tliffiltfestion , 6fAirndrnate•iree& The money:To . ini . , deriiiitOrilhecii,ei: 'Of fafea, was deemoni IMPortinit.eneigic.in Outweigh an other consideraffelittpiskilieniftiamyrant trainer have been reigddrl„Siiliigtini*mii4vrilli'difi.._ comfort, illorentßiflrine , fitriLlMelearlitiess. This heartliiliilWtrinittaffeiiferif 'half never beeriAngititltle4Liitlpiiii*ovliiili road, and the present . arrangements for emi• grant travel indoeirriabis cftyitilolAbihurgli are almbst 'efidalpfefigrf-astothritorkoltravel ling it cOnetifik, pflfrofte:UPPreibli' 0 41ref 3 s . e t a trains T hgt Lthlgi i . ,../ 1 14,`,014"Mi - A certainly_ 11 0; ,_ 44teCumaXioitf.Thetween cheapness' fare andmearineittofacCommo dation', although-Abe ?Map ginehfroritioniil poly moral! 31#141 . *_y . 6 0 ' . iatawiet94tift* i • appears to • . :ft-Wf, 'I. ' •:1"9.. I Onr tAtisensivbe bei m smelt emftteWtheir: trims in Rilifiiiini4BSlitAilEfiPoigetw i e cannot bntnipiciwit i hittlftins f ouga cf :the Central Road. - The future Staildroulf ma strengtliVOtfigiVtadtd.Mni?: l : ker'o Inmineos et Aft ficllitaMallitadtviin Ulf geii4 ral stagnation,_ the interests Of_peettilliy, priest be curs olidliity belicited,' ; *;e : .: i:. =ME ENGLISH OPINIONS ON THE "BIGHT OF sEe.acm ,'" -- Ititurned out precisely as we maid ; ted. Lord NAPIEIt seems not to have AtintightOt worth wale to comm”y lento to =BMW !Government the statetits, the coin the remonstrances d 18 tUnt#htl: State's: Government on the rep . •tea erne) by British n! .2 egi l ire . 4ll ItlitiMeriect and honor. due,,tim :11 , rUfrto June 10, as appeartril9 Plitte 4464 ' ,baraninlthe House of Lords, of that evening, iitotill4utaanuar, the Foreign Secretary, had litiartVo Mite numerous outrages on our mer- Akitltile intfriavenivreinn the nnwspeperti and frotollie. freni told NAMUR, British ‘Ainhattiddrsnat'zArsishitigtem,'• 'whom) 'mostlo4.o)ll.44.lYl4llo'lltatftni"Pan ,iliftikhduld have reached the British Cabinet. 4 satfettiaiSriio ' find Ahrit ;parties in-England - isms. of ono • opinion, este. SPeatti the.ce, right of search't-ontragee., Lord , - OriSinorr, on the occasion we have in-' stance& abltive, declitred.tbat 'lc there Were.lw jitelriedontof .which he bud any;hitowledge, itnder , icoiatintmcar6 of British cruisers Would! be authorized to do what it :witi!said lidd het% "dime,•and if they had rx ,ceeded their her ,Majesty's 'Uien)iiitit , could !Mee n 6 hesitation in 'stating 444;thatiires the poise:', , : , ' PleadileitAitiCEnglitud had 'thh right of lietwoh, buts thatlutving q_twas very different ` , Trom heliiitticeriaided. "that ria ; offieler commanding' a British cruiser, what mver hii stattPloions might be, would exercise. the - right Jeiteintediing au American, , vessel if really convinced that it was bona fide; • ":...6tietieell.."' "Tlifewaii We - opinion of the lath 4 1 ,00 Mjninthr of raigkmd., , .Lord MALMEa , ids presesitsuceestior,mtid, llp to tbis• time •auk inforidatintriirej; tia tt - gfeat measure; !been - derived"- from - ex :parte statements made On the tilde of the American Government. - 11 l .these are , correctly. reported, and proved to have reallyAaken• place as described by the 'American _Government, certainly. her Moist tiieGovernMont are,* pi•eiare4, to justify the,rn." , He added, on -Abe atatement-Abat' Sriiieh Irak. Cruisers - 'llttd'-'l;tought to 'tied -rositiched .American; ships. in,. the- Gilt' of Idoxico,l that neither international law nor •the - treaty, of 1842 would juatify England in taking snehmeasures as these. ,What follows • tatiolOss import:3ldt ., j agree with what ray noble friend "[Clarendon.] has said 'as to' the Au:le:Joan Hag, being oonfitantly pr.:titillated to &ver the slave trade, ' and other illegal acts, and I think it is highly do. :airablethet some agteement should he made be tween the bite - countries, by'whioh it may be dia• tinotly tinditretood what proceedings, Ought to be takenty- their officers respectively for effectually discovering, the "iinposi Cons to ',which_ j have al • ; la q ded, add.Whled(wlll,:not "be r offendin to. hotteet • traders iitoltkat poitif t have ffireotaa the attention ',2ifilie(lovernmetit,of the United States, and that ; - *Oster shut)` in a conversation - which - 1 bad this • ~,,m9;1 4 118 tles„„Amerioan. Minister, and •I• think I .t.raeY,stry tsa+ettessUot been any eleat difference .. 6- i,viel;7 2 ;bettoten Me, After that 60eventation Ithit'beew reporteffAd We:United - St/6es Govern. irietic- after 'the delivery of-the despateh which I este,Written to Lord Napier, and after, the orders thrit had, been sent" to our officers in those gene, I fiepotherewill be "nio repetition of scab acts OR have:teen 'described to ns, whether trot) , or not. Ntris thesoi*ounlitanpei _feel that-flu, country weeettrinsuin• no apprehension that any -eking 0 , 171'40r to' break the, alliance that so happily Opts betweineheewo'countiies. The Litinitajand 'Dili:iv - Mail newspapers are decided in, their tone.' ' • • - (Liveipool) 'says, ,if,Pike right et, search is • wholly - unjustifiable _on the ptirtorourvossolslof-tvar , toWards` the Atieiriaan,.omMercial marine and if a,Bri- 1 has:reesity actedin the way described, he pttistis cathieredas'ityiirnim to others." cif groat Weightls the blanches* Gtiardiani which says; ic From the aynyiilti*MOY.isiiriekittleykriteeitthitio given lointorrOgat:ides 4 - Aliit 'Hough 01 COmmone, itmarbe gathered lit,44,ltiy do not Undertake the.defenekof,Y4o overle Wring, ankve.tistimis de. lryandr'whickhas' hees , , , ; , tributed, , we doubt net ,falie`ty; to the affleery - of the'preventive' rt. rou.'fl - ,qua 4 Bquallp : itiecidedds the Liverpool Timeki yridch ; sl4#l4ll=,l . 4`• clit the f ney, , al forces of Great Brlfiiiq outraged the I iitnorlaan flag) and •Intlictild PerSone injury 41pCoAiiiericikCitiOne r :jlo inkier li § iv plae tllbie tray be:titapretext,.nor &inane the ob iliciti*hitat prompted' - this eonductz.tve 'Shot& apologize, pay a "reasonable indemnity, and give that offences of Mit kind shat not be againrepeated." • Lord Paiitanwrces own organ, the Globe, &la: eel:Jur Government appear to have met the Ain,iu'idiinAltdatefa,ctimplaints,bi antici pation:- ~ i'L e „ii.efelpiiiosloe infieimed Can - pfip:ard not-to be repeated. Tholettemof Mr. CABB, 629 far as we have seen; theM, are written in it[sp). rji of morieration_very unusual :tritif*; " and as our Government appear to :have been. - ,SPirit, there seettm 2 no"reason to'belleve..Ahat anything se- Akena:Wili i e,oixte,out - z•si The Lopdink4tah en:eittremaLiberal organ, 11440, ,to-. Abe - Palmerston-Cabinet; hints thaiprobahlY - the iiffensii p royedtn g if ens: .gruisers' in the ,Gulf of Mexico were ordered . ei :Very different :moth* than *a single-, miitdedderirafaprleeit s of cap- Itured,:ilfrieans into Cuba., '• hcipelhe Adi otLitid Derby ,ent eottrhe. - ,ltAU'itel ii_question - of abandoning Ital:ilin'll i tge;,bist,of respecting the' american :firegovill 4.l4Amribans are determined to make resPected.',i It adds, cc with respect to `,tiejlEin trade, and - the share which American cititeits.lutiXin it, we she nothing for it, un "bititfilit;but to leave it to be` dealt with by the . - dinerieuit Government and people themselves." _Lastly, the LOadort,Timts, of, June 8 , says, 'Willi Oda' emphasis and significance : (c The treaties hifth with - France Mid America having excited niudiau'es lor,-.Zakiaua. to assert ,:*reiiirts oWhiehnostrongendindependent l Power is likely'to;subtitit: pitiiorid done I.Vy iiithrehjng ibe,hign veseeis is nothing:compared ", with 'the bad-blood.. engendered, and though many of tiier"Eio:oilled'outragei are undonbt ndly.hieggeratiOns, enough is known to prove tbetthipraetiee of . searchinevessels under the american ;flag ought tole ended at onee."„ ' " C0L.,TH0N,143 L.;ENIVE. Orti:,itlarlers will be glad, to learn that our _Col. LiTig; , !yettirhed is safety:to his home on Friday eve .:ititigarOutilltah. ' , He looks; naturally enough, ItorgniOdfr(tlilie l iti of traiel ;,bitt, he comps '.,,_hiPVid - buctynnispiritiand hearty good health. t4ari-full of exciting remands and strewn f - rildvincideifek:of peril, has strengthened "rath eitharriMpaired his system; and, to ail appear .aneel.he seems-strong enough to go through si, hidf.doxem exPerlitions efthe'same kind. . , , • Thi‘..litny York-Tribune, in• allnding to his 'return, speaks futfollows Daring this period be blur travelled from NoW "York, - by way of,Saa Francisco and San Bernardi.. , nuietO "Balt Lake - CityLin the depth of winter, Tin - the eurprisinglYabork time,if we are not mis taken, of forty-seven dap. In San Bernardino b.e WAS arrested as,a hicrtnon agent aud escaped with great danger, losing,all furs he had provided for the - tedious Journey Ivetweettt place and the 'Kennon settlements hi Utah. This journeyes we have heard, was attended with much peril ; be was:repeatedly compelled to hide himself under ~the merchandise , oonveyed by his companions, in order to avoid falling Into - the bands of outlying parties Of Mormons, who:would have killed him tts a seereVagent or spy of titti-Federal Government. Wliatdlffiaalties be 'encountered after his arrival at Salt Take City," or bow he• finally induced the Mermen nuclei.' to make„peace and submit to the Federal initherities, will very ‘probably, in duo time, hi . eounnunioated to - ,The public,. Then came 'the ngtralirdinaryride from Sett Lake Oity to the eamp',,Of the United State" ainpy, where, us .0m 'radon wiliremember, :after , twenty-six hosts of conthineus exposure' tp the inclemency of winter, 'Main, if lot all; tlfeilime the saddle, be arrived in' a state torspeeehless' exhaustion. Finally, be m ani on t e d G o ve r ne r Gunorning to Salt Lake Oity, and saw • him inducted into his office •, and than k his mission of pesos amomplished, be came . ;Sink, Goveniment'having disavowed all con nection 'With Col. • H ape's efforts,' the credit Of making them; and of the success with which they have been crowned, belongs entirely to him. 'ln Anil 14gment they • constitute a claim , upon the eatesmand gralitede. of the country which can neYer be disputed. He has avoided the effusion 'of bloodl he has eavedllie papenditure of mil lions; lie hantavtituted peace for a war in which glory - was impossible. Private citizen, he has aeo *kit fill thekowar'or,tl3,Government; could net 'aecomplien t stpaft to tbe ; patriot and ponce 'maker !" • r • , • rtc:arts sari ~th'at the ,entire country will echo' a cordial assent 'to the sentiments ex 'pressed in the concluding PallkirraPh They raie Oreplyjest, and cannot, by any,coostrao tionk,be strained into the langnage,of flattery rew to t ,Yeeng in years have wen so detierved•tend franeriabable a weed of Pu4o4r., ' `, ' " • . • Nnad 4.1) tailllGACCOUntpf the incidents Of the mistiow ofi)ispw itifttitttriltitlslpiWeli)ixt - Ainedeso- PlitiO,Wo,lll4oot QU ; ibutpul he left ferlVashlngVil at ltn orely hour I taitirdsy;iftlutc,rie' 3 4oo.ortnniWpf, Plai t :: 4 4 413; "3' so that itoranlyinict lieu! atteadttfanprri!f iirettpl* - ildptd;aia *go' e /I iipqn "subject; we are ribtie.yecelpt JoiythrOnnstion. , - . EIS LATER EUROPEAN NEW English journals of the 9th inst. (received, we believe, by the Vanderbilt, through the Associated Pressj inform us, in addition to what we have given relative Wllie "zjght• of eparch "„ . questlori, : that on, ::the - pi:F(o9+94 Oie_Vomi4one4tekpassed a bill by 496. and,:ithat airErky,'s motOeor Icave to bthili 4*i to k eigse the4etes of - , , parliareeßtaty •e .r to be taken fliwiiy of Bailiot , Wasje.:' jected by a majority of 97—the members being 197 for and 294 against. - 74.WALroLE,..the_Tory_. Home SeCrotary, opposed the motion; and so did those pro fessed liberals Lord PALmEns.rox and Lord ' "-* - - •- • Thera IA no:other news of: interest in these papers4-4pOpt that sc . * successes. India are reported, and that it was believe& that the Commissforier sent • by the 'Emperor of China to 'Canton was gathering filmes' to 'attempt the capture of Canton. • PUBLIC ENTERTAINMENTS For the PreSent, it would seam that theatrioals are hors de combat I n this city. Mrs. Beware had a very lucrative Benefit, at Walnut-Street Theatre, on Friday. at whioh the public rejoiced,. for she' is deservedly popular as. a'very clever actress.' WO hoar that the interior of Walnd-street Theatre is to be remodelled during.tke recess, but this rumor may be incorrect Wears informed that Mrs. Bowers `Will resume her occupation of the "old Walnut," 'When the summer is over. We recommend her, if she goes in for improving .the establishment, to got a good, practical, modern manager, with only his employer's interests to take care of. It was said, • in private as well aa,in print, that' _tie National Theatre would ,be re-opened . this evening; 'with a - good stook company, by Mr, -John 11:, MoDonotigh -and • Mr. Joseph o.'Foster:- -We see : no • announcement, and prestincii that there is a postponement until better theatre= attending weather. The Keller troupe, increased to slaty artistes, (a ballet corns included,) commence a short en gagement, at Wheatley's Arch-street Theatre, this evening. Their living pictures were classical and beautiful, famturpaaiing anything of the kind we have - ever iree, realizing some of the Boost pictures • ever painted: ;What the addition of a ballet.and a pictorial drama 'may be it is Impassible to say Without having seen it. The price of admisiion, we see, bill be uniform and low—twenty-five (mate. COMPLIHENTAIIT BENEFIT TO JOHN BRINKMAN. —lt is the inteition of many of Mr. Brougham's friends in this city 10 give him a complimentary benefit. Neither the time nor theatre has yet been ,determined upon, but we understand 'that Walnut-street Theatre will be the place, and that some evening this week will be the time. We, shall state particulars as soon as any thing is de. sided. - Meanwhile, we would merely add . that no man better deserves a substantial compliment of this kind than John Brougham, whore we are Protid• to call our friend—every. ono is proud of him.. Author, artist, actor at he is, he has as many claims as any one we know to the title, so rarely won,_ of a man of genius.' He has writ ten some of the best .cornedies, the moat "scream ing" farces, the, most amusing songs, and the very best burlesques of any maw living., -TIM • humbei of dramatic 'ileum, of ell sorts, aotualiy written by John Brougham since lie „came-to this country ore eightreiz in number ! He has a pe culiar claim on the menrbersof his own profession, who, .we, know, will gladly cooperate with his friends and the publio to make this a real, not a nominal Benefit—for he bee always shown the greatest and kindest alacrity in giving such of them as wanted it the advantage of his own talent and Popularity. Lastly, it is noronly as an orna ment to hisprofeasion, but as a high-minded, in telleetual, honorable gentleman -that he has a regular army of claims upon public, favor. THE GAIRE OF CRICKET 44 Tha Judge. to dance, his brother sergeants call ; The Senator at (Jacket urge.the ball!'—Pori. ' ro a'oommunity like, ours, where young persons aro always engaged in Scholastic or mercantile oc ormatiord—where industry Is always encouraged, even -among , youths whose means require it not, in preference to lives of indolence—it is absolutely nicessarythataSortfloient amount of bodily cm- Oise be indulged in to counteract the debilitating effect of constant mentaler manual labor, The distaste for athletic sports that has always marked the youthCf this country, and, per con sequence,, their manhood, has been a grievous error ontheir r part, and has elicited from foreign visitors remarks- equally of wonder and censure. Look at the 'reboot' German, and you See, in' nine cease out Of terr,:a man who has spent many hours of hie youth and manhood in• the gymnasium. Ask the broad-shouldered Englishman to account for his muscalar and powerfully-doveloped appear ance; and ho will probably tell you, " Per five years of my collegiate life I pulled the stroke oar in the Firefly," or, " When at Eton, I was the captain of- the arab -eleven of cur - ertelfet club." In fact, athletic grunes'are considered by them as essential elements eradication: Every regiment,. hi-England and the colonies -has its orieket club and ground ; every college and free s6hool has ifs three or four acres of orloketing ground for thomholars; every town of ten thou- Sand inhabitant)! his' its "Town Cricket Club;" and when has-it been said they have in-any single oase been productive of evil ? On the contrary, the prefessore and prevoeta of the Universities will tell you their Motto is'" wiens, Carta in torfiere scab," and will refer von to their archives of in terior and exteriercollegolife; where you will find :uppermost on - the; More-book of the orloket-field the flames of men who in, after years have dietin ,grestord themselves-in the pulpit, at the bar, on the bench, and on the 'battle-field. One striking instance is that of Captain Lasada, the first man in' the Roden fortress, who le a perfect cricketer, andplayed with the Canadians against the United States at New-YorivinlBs6: . And we are happy to bo able to say that within the laid three, years Yining America has taken this matter into' such serious consideration, that ere long it will be ranked as a Narrousn Gamu—and why should it not? Have we not the bone and sinew, the activity and energy ouMoient, if, wo but assist in their development? Have we not as many .interests at stake as any other people, to lodge° ns to preserve unblemished one bodily and mental strength? Have we not a vest territory which should be peopled by the sons of zeal and energy rather than the asking , of indolence? Yes t We would say to the rising generation of Philadelphia, Quit your billiard rooms and your cigar smoking, and join a cricket club, and, without ; neglecting your „varloris business vocations, endeavor to spend a few lours' in the week in one'of tho most &a hitorating, gentlemanly, seientiflo, and amusing exercises known at the present day. , To parents no would say: It as much to your interest as to your ohildren's,_that their tastes for this or anyother such athletic sport should be en °enraged: &oche • fit Youth is the best antidote doctors' bills, labeling Maohines, balsams for pulmonary diseases. and trips to the South. .To employers a word also "All work and no play - makes Stork a dull boy," and if you study your own interests, do not keep your clerks and salesmen pent up, from morning till sight, but amid themin search after physical exercise. -That all inay have a fair opportunity of judging Orthe merits of this game for themselves, we are happy to be able to announce that on the Lth and oth of Julystext the groat annual match, botween eleven,linglishmen and eighteen Amerioans, will bo - played in Camden, otithe ground of the Phila. Aelphla, 'club. The' players, will consist .of. the most talented orioketers, selected from all parts of the-Union , • an we shall expect to gee present a strong muster of our olthens who are ativooates of eo noble a calm,o. 0. • THE WAGES OF MINERS. [For The Preis.) Rome persons-having called in question, the truth of my statement in The Press of. the 17th, with respect to the,wages of miners, I will submit the following statement, as a-great deal of misap- prehension mantle exist upon the subject. I will take - the wages ot four men, who aro by no means 'considered as skilful miners, but simply bard working Once possessing but little experience. One is a native of Ireland, and never saw BMW mine until he came to this country; two are Germans, and one' a Welsbman - who never worked a, day in a coal mine until last summer,.when the Danville iron works stopped.- -No. 1. Nathan. Mined 269 care of coal at 40 cents per oar. Amount $107.60. The wages of his laborers, unto whom be paid ono dollar per day, amounted to $29.00. The powder and oil be used oame to $82.87, making a sum total of $61.87 against $107.60. Ile worked 24 days—month ending May 3l—and cleared upon an average $1.90 per day. Not so bad for a man, these hard - times. Bad this.-man 'possessed the skill of some experienced Welsh or Cornish miners, be might have saved at least two kegs of powder and mined fifty cars of coal more. , Nog. 2 and 3. Two brothers, Germans. Mined 200 oars of eoal—amount $30,00 Deduot for powder, oil, &o " 10 04. Leaves them $69,08 They worked twonty.flve days, and averaged UN per day each. No. 4. Welshman, green hand. Mined 47i oars of coal, at 70 cents per oar, and worked three days as laborer at $1 per day. Averaged $1.25 per day 'for" twenty.two days'. work.. It,musthe borne in mind that these men have been• selooted because they wore not, by any means, first-Wass minors, so that no camera- could sayi bed.drawn an exaggerated. picture.. •.• Miners rarely, ma' bodyi work more'than eight .hours a day. Many of them will go in to work at eight o'clock In the moreincand come oat at four or five o'olook in the afternoon. , And yet, in view of this fact: htunilrbds of them in Carbon, Leitrim, and Schuylkill counties; are',Prowling about, Idle and sldftleesirefusing to work, upon thalami. that they cannot live atthe present prices: Is it not strange that men prefer to act upon the suieldal poll . g j it , that no brand at all is preferable to hal f a , S. B. IL • *IX Town COLLTERY, .1nn9.1.0, Mg. t' g§§.- MONDAY. Mkt 21, 'AM BY MIDNIGHT MAIL. LETTER FROM ,‘ OCCASIONAL." [Correspondence of The Press.] , WAsitotarP7t, ,D11?%•20;1!PS. The nomination of WilliinOthafinitieri Democrats of the tiVentleth:ditOlut; inionynata,: is to be opposed, regular tit)';itA6. - , 7W 014 hattbcon• issued, that the pcatinaitex; itt,tthCihroir. To*, in g ton, 'that'ilietriet;:lit*he he is Montgomery's' friends- ;Tear hum). ijitdik Black, the . Attorney-General; to saidlo Violent assailant of Montgomery, and, one of the men who assert that the regular nomination is not binding. He advocates not only war upon the prinoiplea; but also the usages of the Deinocratki party. We 'have, indeed, fallen , upon - strange times. ThO Deiei'orits Of - the Stated Indian's - indig nantly refused to submit to.this order or things: ThuA submilsive ,Lecomptonite Hughes, who at tempted to get into, a diMottlty,with Col. Barris, of Illinois, will be thrown over hy an immense ma jority. - , Judge lloyei has taken the told as the °pint.' Ilan candidate for Congressinan from thefirst die- Irbil, of Indiana, now reprellented by Mr. Niblaok, Lecomptonito. The Judge appears-lo be' sup parted' with great cordiality, and to have the entire confidence of the people, as ,a Suitable per son to'represent them. He Is an Anti-Lecompton Democrat, but Republicans and Americans are likely to vote for him with the same unanimity as if be had been of their own political stripe hereto fore. A WO body of Democrats in his district repudiate him. In Ohio, I do not see a show for any of the Loootnptonites, while Michigan, 'lowa, and Wisconsin look no less frowningly upon all of the same stripe. • Grand, the Hessian, has produced a split among the few office-holders of Chicago. He started, from hero to do it, and ho has done it. A German called &shade, who a few months ago was a Douglas Democrat, was induced to go for Lecomp ton and against D., and to start' a Leeoinntori paper. 4 Biit thii did 'not'answir 'the 'managers bore, Bigler; Jones - & 06.,"a1d Grand Was started out to supplant Sobade, which he' did after 'll , fashion. The latter Is Indignant, and threatens to expose somebody. Grand will hold on until the pay runs out, when you will see him deserting in a hurry. ,Letters from Beading, Pennsylvania, state that Mr. J. Lawrence Getz, editor ,of the : Gazette at that-place, has 'written the President, throning up his elloo'of Visaed agency, which Was divided between a man named , Ranter, another named Smith, and Mr Getz. The idea of an ax-Speaker of the House of Representatives taking part of such a - distribution wax too,mueh for Mr. Getz, and he retires. , But what makes matters worse is the fact that Mr., Glancy Jones, idle was to have been- re=nomintited for CongresS, and to this end was allowed to parcel out offices and °entreats. (making himself as is supposed, partner In some of them,) is already deserted by the veryman whom it was supposed belied "ar ranged." The apothem men who helped Jones for ward, and,who answered his toadyism by pushing him upon Mr. Buchanan, are anxious that ho should hi kept at home or sent out of the country; they care little which, so that he is not inflicted upon Congress for another term. [Reportei for The Ppm.] MOTTING. AT POINT,BRENZE PAT:K.—The atten dance at the park, on Saturday afternoon, was quite large. The horres entered were McDonald alias Thunder, (formerly the property of Mr. Stot eon,) and llonest'David, an old stager, but a good one. McDonald is a beautiful gray gelding; and a few days since made 2 37 on the track without pushing.' He has been purchased, we understand, by a gentleman from Baltimore, whose name he bears. At the start the odds were in favor of the gray; ho did not, however, appear to bo in good condition, and the result of the I' trial " showed that he was not. SATURDAY, June 19.—Tretting--Beat three in five to harness. Premium $lOO. George Woodruff entbre b. g Honest Darid..7. James Dwell enters g. .McDonald die Time: 2.38 F-2 lin. The first beat was beautifully contested and created a lively excitement among the spectators. The horses wont off in splendid style after two ineffectual attempts to start David and MoDon. aid hugged together for about five hundred yards, when the little bay made a bad break and the gallant gray passed him, leaving a gap of about three lengths up to the firstquarter pole. Before the second quarter was reached David had his nose olose fettle gray's wheel and kept in We position until they swung around into the home stretch. They both now strained themselves to their top most speed and came down " kiting." .When near the - score, David had the advantage, but made another awkward break, when.the big gray glided past him, winning the heat by about a length. The second heat was no contest. MoDonald, after he had crossed the score about 25 yards, east a shoe. Before ha had got a hundred yards fur. ther be lost another shoe, and as be could not trot barefooted, ho was distanced. and lost the premium. Mr. McManus now rode Flora Temple around the traok, in order to give all presentan opportu nity to see coo of. the_finest_sweitimene of a knit littleTeare on the turf. The weather was oppreseivelv warm and the friends of Honest David and McDonald bad waxed much warmer in discussing the merits of the two horses. A dean was called In, and without much ceremony he put on Mao's shoes—ugly and clumsy 16oking thing's they wore. A private purse Was now made up, and the horses again called to the stand. The first heat showed that they were pretty equally matched. They hugged closely together coming.down the home stretch, and when within a few yards of the more the gray lost a shoe and went up, and the bay won the beat. Time 2,37. The shoe *as put on In time for the second heat. But it was of no use, as It would not stay on. The bay got the heat in 2.37.1, and the premium in lees than no time. - The members, we perceive, continue to make improvements on the grounde. They are deter mined that nothing shall be wanting on their part to render it the moat perfect track in the world. Mr. McDonald, a young millionaire from Mary land, we understand, has purchased Flora Tem. ple, Grey Beard, Thunder or MoDonald, and wo think we beard somebody say that pair of mules. To morrow Flora Temple and Lancet have a trot at Oxford Park for a premium of $l,OOO. The attendance, we have no doubt, will be very largo. Lancet appears to be the favorite among the knowing ones. (For The Preis .1 The slow progress made by the world in the acquisition of knowledge is said (by Dugaid Stow art) to result from the propensity of the Littman mind to form general conclusions without a proper study of individual facts. The tenacity owith which many minds cling to a theory which, fads,, easily ascertained, but which are studiously ignored, would show to be wholly false, is an ovi dance that the science of reasoning has not been no carefully taught in our schools as it should 'lwo instances in point worm in Thursday's Press. A "Friend to Domestic Industry" talks about "equalising the ourrency ;" and Bays that while "fifteen hundred corporations have the power to increase or depress the representative valise of the dollar ,* * we shall forever vibrate," A:. lie assumes - that the banks can " increase or depress the representative value of the dollar." Is tlicre any nor more conclusively established than that they can not? De evi dently thinks, too, that an 'extended paper our relay is pimplier to this country. But eon he, bo ignorant of the fact that the paper currency of England (our groat manufacturing rival) is of greater volume, both absolutely:nnd relatively, than our own? Or can he be Ignorant of the feet that the currency of all Europe (whether metallic or paper is immaterial, for the effect is the same) is considerably greater per capita than that of the United States? Add yet, In view of these facts how absurd are his theories ! 'He seems to think that a narrow currency causes low pricer, while an expanded currency causes high prices. Lot him consult thepriges of iron, flour sugar, and cotton for the past fifty years, and he Neil I see that there is no more connection be tween them and the currency than theta is be tween them and the changes of the moon ! If a narrow currency produces low prices, and an ex panded the opposite, prices in hard-money Ar kansas shtmld rule lower than in Rhode Island, where banks do most abound; but who does not know the reverse is really the case? If a "Friend to Domestic Industry;" and all who think like him, would only study the simple and easily accessible filets In the ease, there would he some hope for them ; but of this I am not sanguine. Our free-trade, hard moneyfriends hate blots worse than John Randolph did sheep. Mr. James Wall hopes we trill adopt the English doctrine of "free-trade." Here, again, is a re markable ignoring of the facts in the ease. Of free-trade, as understood in this country, there bac never been a particle in England. No country in the world has so constantly or so skilfully pro. (acted her manufactures as England, When there was a contliot—more' apparent than real, as the result shows—between the agrionitural and menu lecturing interests, the latter triumphed. But there is no analogy—not the slightest—between the condition of England and the United States on the tariff question, as any one who has even a limited knowledge of the subject ought to know. But I am not going into a discussion of the tariff and currency questions. I only beg leave to pro test against this reiterating, for the thousandth time, theories which an hour a study of particular facts wont,' show to bo the opposite of the truth. AN AMERICAN MECHANIC. On Saturday, at Messrs. Earlos' pioture•galle ries, in Chestnut street, we bad the satisfaetion of seeing a very fine work of art—the portrait of Go vernor Packer, painted by Mr. George W. Conan roe, of this city, for the Capitol at Harrisburg. It is admirable as to the resemblance, and equally worthy of praise as regards the pbte of the figure, the naturalness of the flesh-tints, the manage ment of the chiaroscuro, and (what makes the especial value of the portrait) the expression of the features. As a work of art, this will be a valuable addition to the portraits of gubernatorial personages iu the Capitol at Harrisburg. Plovontar. Nrwarernns Memo. Oat:en der & Co., ilouth Third street, we have received the illustrated London News, and Illustrated News of the World, of Juno 5. Both are richly illustrated, and the publio will 'certainly gain by the oompatition.. We have /AM received, from the same tummy Harper's Magazine for July, a capital number. • Ciaacomi, the Italian; has been a second time ooriviotod of murder in New York. OCCASIONAL THE TURF FOR 1_558 FH LATEST NEWS BY TELEGRAM . • Col. Kane of Washington—Bespatcp* froit ' GOVPlTlOr:cummin. • , Wasnittorott, JUO? 2 0. ; " 0 ° 1 . Hankerrlied here, fast' night,' bringing,. d,itipatches .frinAtoternor - Ciamtning, : vrlioin.he left at Camp,i3aaitten the,l6th • of Iday: , - , l 4 l4[vrererti3OPyore4.tilitie Prield t tthe linttedirtes. - „Thkr , Purliert - 114:0refliolilly-' Affi:nspired; et MAARa tatneirthaefitioffforjhe' tlediMOtt ,01 the:publio' 'prikoMplell'are errorieous; andoalculatid oeive the country inxespeat to Utah matters gene-,, ' rally. To this fact may bo attributed the refusal of Celonellane to communicate with the press. It Is understood that he denies - the truth of the tele 'graphic, announcement front Boonevills,lutimat ing that the' artily would move on -the arrival of the pesos :stommlssionersorhen,in foot Governor Gumming has requested i General Johnston to re main where be s until orders shall he received from4Veshington. Cositrarrio the'reports widely oireulated, Colonel Kane does net admit thatthere has' been any , such want of harmony between -Governor Cumming and General 'Johnston, as ,wouldjeopardize the public interests. Ile speaks In eitlogistio terms ofGeneral Johnston, and the high state of discipline in which the latter Maid tallied his forces, and of the praiseworthy to frit manifested by the ono/ during the winter. The friends of the AdiGntstration are mush pleased - with the manner in which , he is understood to allude to the aentinet of Governor Cumming, say ing that he is deserving of the 'gratitude of the country. There was a great hope in Utah, as well as else where, that the war was at an end. A peace party had been formed, and was sufficiently'Strong In time to arrest the-. march of the Mormon ,forces against our own last spring, It was the impres sion in Utah that Brigham 'Young, whit openly espoused the cause of the 'United States,-would In this respect be able to maintain bia,positiom - There was at one time a strong opposition to him before emigrition was' resolved 'upon, but ever since this feeling - of hostility has been sub: Riding. All the northern settlements are evacu ated, with the exception of, the few Meniteris left to guard the nubile prep:WV SalrEake 'City;' besides these there ere no Mormons forty miles south of that oGy. , The seventy Mormon families alluded to in the ' recent 'despateh. - did xot; as stated, apply -to Governor 'Cumming at Camp. Scott for protection,: „They ,worojr,onght ‘ them by him from Salt Like " indium:Treaties. WAsnisuxoN, June 20.—Two treaties were yew terdnv entered into at the Indian Bureau with the Upper and LoWer Sioux. ef-Minnesota, the oh. ;feet of which Is to oonfine them to a portion of the reservation set apart under the treaty of hill. to quiet the land titles end provide them with per manent Moles, with the usual educatioVal and in dustrial assistance. Later from Ilovana—The Steamer* Fulton and Water Witch- AmerteanAltipmasters Determined to Resist the English. Cruisers. Nnw YoTitc, Juno 20 —The steamship Mick' Warrior has arrived with Havana dates to the 16th instant. The United States steamer§ Fulton and Water Witch .bad touohed at Cardenas, and resumed their cruise for the British steamers Styx and Buzzard. The American shipmasters, at Havana, hail called a meeting to act on the basis of Mr. Sickles' resolution in Congress, and put their ships In fighting order so as to resist British aggressions. The Danish ' barque had landed 302 Asiatics at Havana, a large number having died on the voyage. The. coal piles aro still on fire, and the loss will not be less then $lOOOOO. A report. hae reoehnd Havana that a slayer wee oaptured, on the south vide of the Island, with 900 Atrialllo on board: - Tho stock of Fuvr Willi 300,000 boxes. Ea.:lbsen° on London. 12 per cent. premium ; on Now York, to if premium. Later from Rio, BALTIMORE, Juno 20.—8 y nn orrival to•dny, dates to May 13th have been received from Rio Janeiro., ' Left in port—the Soa Foam from Now York, just arrived. 'Bohr. Josephine from Now York, waiting cargo. The ship Jarolinto. from Now - York, bound to B;nsapore, woe spoken May 21st, in let. 22, long. 36 30, then 45 days out. The American Bank at Baltimore. BALTDIORE, June 19.—The American Bank, which. lately opened in this city under doubtful circumstances, °bleed its doors this morning. It is supposed to have considerable circulation in the West. Its funds have all been drawn from the Bank of Commerce. Affairs al New Orleans NEW ORLF:+ns. June HI —The lion. Charles M. Waterman, who vacated his position as mayor of the city during the usurpation of the Vigilance Committee, has been reinstated to oompleto the balance of hie °Metal term. Fire at Troy. t TROY, N. Y., Juno 20.—The extensive flour mills of Messrs Thayer.it Usher worn .destroyod by tiro this morning. li"a.. $4O 000, upon whiob there was an insurance of $27,000. CINCINNATI, Juno 19 —The river is falling rapidly. The weather continues line, and favor able for tho crops. The Politicians. [from the San Francisco Evening Bulletin.) The Philadelphia Press has caused quite a flut tering among that largo class of disreputable poli ticians who hang around the Federal Capital from one year to another, doing the dirty work of par ties. and putting money in their pockets by acting as "Jobbers.Lor-.' brokers" in the passage of nefa rious schemes to fleece the national treasury—by declaring lie intention to expose their corrupt practices and hold them up. to the public gaze In its columns. Already one or two notable exam ples have been made, and men with high-sound ing titles - and magnificent pretensions shown to be little better than sharpers and knaves. This course, on the part of The Press, is emi nently proper, and if ate example wore followed by the newspapers generally of the large cities at the nut, the frequent charges of corruption and fraud made against members •of Congress would be allowed, and as unconscionable a set of scamps as ever lived would be formed to forsake their disreputable Withdraw the public confldenee from those harpies. or rather let the people plains their seal of condemnation on them, and view all offielals with distrust and suspicion who assoolate or affiliate with them, and their occupation is gone. Fellows without character or reputation at home—or rather whose reputa tion for all that is vicious and bad Is notorious— go on to Washington, and by means of unblush ing impudence, a title of some kind, and a grand display of paste jewelry, manage to pass them selves off as the magnates of the land. We frequent ly-hear the remark "as easily gulled as a school girl," hut we have often thought as wo witnessed the manner in which members of Congress and State Legislatures were imposed upon by the fel lemma have boon describing, that the remark certainly did not embrace the most gullablo class. It leas natural for mon when placed in power-- like the ass in the fable who took to itself all the homage paid to the holy image which it but car ried—to become puffed up and vain, taking to themselves, as individuals, the honors paid to their positions, that they aro an easy prey to the first unscrupulous rascal who may cater to their „vanity and folly. Probably no people in the world have suffered more from these political sharpers than the people of California. For years they " ruled the roast," filling their pockets with the gold wrung from the bard earnings of the people, and corrupting anti pct. soniug the very fountains of public and private vir tue. They have loft the trace of their hands upon every branch of business and description of indus try. They have nearly bankrupted the State, and made the name of California a biasing and a by word among the nations of the earth. Seeing the evil, and appreciating fully the responsibility and the remedy, the Bulletin suede unoompromis log war upon this'elass'of politicians. or t, Ureters, who have so Icing drawn the very life-blood from the Commonwealth. What The Press is now doing to "clean out the Aegean stables" at 'Washington, the Bulletin has done faithfully and fearlessly in California, and not entirely without good results. Tho infamy which attaches to the .names of many of these follows in the minds of the people, and their inability to do harm, is owing to the feet that the people have boon made acquainted with their true character—their note of infathy and disgrace—through the columns of this paper. "Vice is a monster of such hideous mein, That to be bated needs but to bo aeon." Railroad Mallers.—Tho annexed is an offi cial statement of the receipts and exponsea of the Pennsylvania Railroad for the month of May, and since the Ist of January, compared with the cor responding periods last year. It will be seen that the gross earnings for May show an increase of $74 923, and the nett earnings an inerenso of 3013,802. Since the fist of January to the 31st of 14av—five months—the gross earnings amounted tet52,197.920, against $2.204,300 to corresponding date last year, showing a decrease of $6.374. But iEnvlll bo seen that the expenditures have been minced $103.389. leaving an inoreas.e for nett earnings of $167,015 The nett earnings for the Rtte months amount to 5994 678, against $837,063 to fame period last year. This is a most gratify ing exhibit, and demonstrates conclusively that the Pennsylvania is one of the best managed and best paying roads in the country : (irons earniuga Psi:mesas. Nett earrOn $480,476 02 260 778 20 219,650.88 405,553 07 204,657 38 110,595 69 May, 1858.... May, 1864.... 74,923 56 78 2 802.64 3 819.09 Froin January 1 to Anal, 1868. .. 2.197.020 251 203 257 09 904.074 00 Sauio Unto in 1657, 2,290300 69 1 300 017.55 537,03 04 /acreage...... 757,1E5 52 'Morose ...... 6,374 94 163,889 80 The canal dopartment of the Pennsylvania Rail road Company is also doing very well ; but as the canal did not belong to the company a year ago, we have no means of making a comparison. The earnings of the canal, in May and for the season, were as follows : Gross Earnings. Expenses Not (mega. Earnings may,lBsB. .... $23 666 81 7,064 74 16,602 07 Jan. Ito Juno 1, '5B. ... 44 688 42 43,714 80 868 62 Net earnings of the Canal from August I, 1557, to Jan. 1, 1858. ...$10.243 40 Jan. '5B, to June 1, '5B 869 62 e‘ Aug I, ,s l t toJunel,'sl3 . $20112 02 Tim Northern Central Railroad is completed to Sunbury, and the first looomotive passed over it on Thursday. By this manna a new and oontinuous railroad will be opened from Philadelphia and Baltimore to Sunbury, Williamsport, and planes beyond. Burglary.—About four o'clock on Saturday morning thohouso of Wilson J. Jenkins, No 1485 Filbert street, was entered by burglars. Entranoe was effected by breaking a slat out of the Venitian shutter of the bath-room, andthen undoing the fastening. The scamps packed up a quantity of silver ware, but thoy were seated oft before they got away with it. The only articles stolen were two or throe EAlvei. salt.eellars and a few other artieles of no great value FIRAT PAM—American Literature; Meeting of the Demoeracy of , Venting° County ; Farther Particulars of the Explosion of this Pennsylvania; Euiapean News by tho steamer Vanderbilt; Late and Important from Camp Scott; Interesting Eteroises; Oilleerti Elected; General News. Foment P 61311 —List of Letters remaining in the ndladelphia Post @Moe up to 121 M., Juno 19. THE CITY. AIMBEMENTB TIIIB EVENING /1.1108 EITIMET THUM. ARCM STAMP. SIXTR.—" Joseph In Egypt," " The Enchanted Diweril , ti Temple of Liberty." Oorse Tamer.—Sire have often heard xtE , those vitae hair/possessed extraordinary power etinitinimalt, Wiled, we have seen within our own +difix_and.generitioni4he: influence of a Van Am- Itgr of 'a over those animals inputed to 'belong to the fterciest and most untame. .la% •speites.-• - Hut there - have oftener appeared those who professed to possess control over domes tie animals. Tho number of those who have pos.. Bossed real pawer, and those who were mere ad venturers in this direction, has been very great. Indeed, -- those who have been styled " horse-te rtian'? have constituted the moat numerous of these classes. Many of them seemed to hare in fluence of a most. strange and to the:popular mind meet unnatural character, over the equine race. Hence, `anciently it wasitaidL they +bad discovered charms or " secrets," which were drawn from the stoics of 'Adult learning. Bat the popular idea upon this subject is simply absurd. Neither oil of summio, or oil of sodium, or other chemical coat pounds or distillations,, eau establish secret yet powerful sympathy between any man and animal. Bach an idea is based upon a philosophy equally as falsetto that which causes-human credulity to put trust in amulets and love-powders. But aside from this moralizing, we went the other eftetnoon to witness the performance of , a Mr. Emmons. He professes to tame horses, mules, or ariy'ether'ununber of the equine family, whether related by affinity or consanguinity. The exhibt , toots mane off in the arena of Modena Miale's rid ingOsettiol, " About a dozen persons Were present. We waited about half an hour after the advertised time•ere the hero of the ring entered. In the cor nor_ef the'arena stood two mules,WhiOhlobked as if they expected to be Victimized. 'They'showed no signs of .vicionsistint, and had evidently been worked , before. Upon inquiry, we learned that the person who bad broken them and driven then' for thiee years; had quit mule-driving , to go to people-driving. In other words, he had been pro-. motel to wearing a stir, by Mayor Henry. Since his elevatiori, nehOdy had been able to get on with his Males' They' would admit no stranger into their Stalls, and would let•no one harness them. Mr Emmons began hie ()Orations quietly but Lefreatively upon one of them, ,andeontinned them fee about an hour.— Iti +was in- vain' the - mute reared and kicked, and dembiestrated his strength by all, kinds of nabobs: 'Patience, perasiveramae, and good temper conquered even a mule. In less ' than an hour he made-that mule follow him—a stranger the animal bad never seen before—like a dog would his master. The second , Male, after a similar contest of strength, was eiompletely subdued ; but Emmons declined to continue it longir. We doubt not ho would have been equally successful with this ono, notwithstanding it was far shyer and more un tractable than the first. We suppose he will train this -animal further upon some future occasion. We believe he expended more time upon these mules than he would have done upon a half dozen horses, the former aro so much moro obstinate and unyielding than the latter. , - " A high-spirited mare was then introduced. Her particular fault seemed to be unwillingness to sub mit to manipulation, and her disposition to resent any touch about the region of her stomach. He began the same test-with her. It lasted, how ever, a much shorter time. She was mush sooner •subdued• He reduced her to complete obedience; insomuch that she could bo freoly . handled any where when he quit her. There seems to bo no see* in this success. Such more mechanical appliances are used as place the strength of the horse at the will of the man. Tho latter patient'y continues the uppliontion until he has demonstrated to the animal the fact that its will must succumb to his. He never lesss his presence of mind. He is always kind-temper ed, never speaks otherwise then soothingly and gently to the horse. In short, as a friend remark erleptly eeneerning it •t Batmen's shows the horse that he is muster and then usas his power most kindly " He is a men about, five feet teujnehes in height, oloan-limbed from heels to head. Tee lower limbs aro well developed, but not very large. Tho chest, shoulders, and arms evince great muscular power. He has occasion often to show the greatest twilit' , when a fierce, strong animal is writhing in Use dust, and seeking, by the most powerfuressays of strength, to regain an upright posture. But he always avoids entanglement with its heels, and is ready the moment it rises to renew the struggle. When he has completely conquered an animal. he lays himself outstretched upon it. lie draws its head to his, puts its legs ever his sits upon. its body, embraces its and, in short, assumes nil =IEZ possible or conceivable attitudes about it and around it, and the animal quietly submits, how ever vicious it may have been before. Upon the whole, we regard it as a verx wonderful triumph of patience, skill, and kind treatment—the tri umph of intellect over brute force, in a molt emi nent degree. There is a peculiarity about this men which seems to us to indicate his entire confidence in bie power to achieve successful results. Be works and does not talk. Ile appears to think his ac tions are so simple as to illustrate themselves, and to need no talking to explain them. At the close of the exhibition he did consent to talk. It scented to impose a harder task upon him than to subdue a vicious mule. He did it in short, broken sentences. It was for the purpose of instructing those present in the method of bridl ng a vicious horse, which was alike given to biting, striking with his forefoot and kicking with his bird. Ho did it in the very fewest words, and in so simple a way that all understood it and would remember it for life. If this horse-tamer and mule•coequeror had lived in Sparta be would have commanded Immense favor from his laconic brevity of speech. It is a groat virtue, either in horse•tamer or man tamer. Is It not a peculiar evidence of power? Found Drowned.—A view was held on Saturday, by Coroner Budd,. of Camden, on the body of a man found floating, about seven o'clock In the morning, in Cooper's Greek, about a mile above Starr's foundry, by Mr. William Pigeon. The body was dressed as follows A heavy dark cloth sack coat, blue cotton pantaloons, check cotton shirt, and long boots, and in the pockets wore found a Small sum of money, a silver watt*, a gold slide in *the form of a heart, a knife, bunch of keys, and a note, of which the following is a copy : FONTAINEBLEAU FARM, near Bethlehem, Pa., June 1 I th, 1858. "This is to certify that all difficulties heretofore existing between myself and George Bryant have been amicably settled between us, and that I have no further (rause of complaint against him. "DANIEL lIOFFERT." The body Was consigned to the care of Messrs. Roberts k Son, undertakers, corner of Third and Federal streets, and by them decently interred. We learn that a person answering to the de scription of the deceased was seen on Wednesday last, in the vicinity of Cooper's creek, and that his oonduot induced the belief that he was de. ranged. A young man named Anthony Taylor, twenty years of age, fell out of a boat, on Saturday, at Palmer—street wharf, Remington, and was drowned. The body wee subsequently recovered and taken to the houseaf James Thompson, Ilano vor street, below Franklin. A boy named Scanlan, twelve years of age, w is drowned on Saturday evening. while bathing at Gillingham's dam, near Frankford. The body 1481 f recovered. On Saturday afternoon, a son of John Kaiehline, residing near tho Falls of Schuylkill, was drowned while bathing in the Sohnylki . ll. The coroner held inquests in these oases. Philadelphia Naval Station.—At the present time there is much activity at our navy yard. Over twelve hundred persons are engaged, and there is every indication of employment for more The work on the sloop-of-war "Lnimaster" is pro gressing steadily, and she promises, when com pleted, to bo one of the most beau'iful specimens of naval architecture, as well as efficient vessels, over launched, even from a Philadelphia ship yard. Wo understand that the usual monthly expendi ' ture, in wages paid to the laborers, ranges from forty-five to fifty thousand dollars, and that this lies boon the average amount expended during the lest two or three years. bones it appears that the Government yearly distributes among the ship wrights, and laboring men generally, employed at our navel station, over half a million of dollars, which is not only of great moment to the men who earn the wages. brit to the community in which they spend and circulate their money. Better work is not done at anv other American navy yard. and the favor of the Navy Department could not be bestowed on hotter men of their profession than our shipbuilders. Military.—The Cadwalader Grays, Captain Breese, will make an excursion to Bristol to-day. for tarzet practice, leaving Arab-street wharf at. &cloak. They will - be eeoompanled by Beck's Philadelphia Band, and expect to parade fifty mus kets. 'lf the weather should prove favorable, a number of ladies and gentlemen :will accompany the corps. Wbeltley's Light Guard will make their first parade nn Monday, August 23, on whieh occasion they will have a target firing near the town of Progress, N. J. Hospital Cases.—On Saturday evening, a young man, named James L-ifferty, aged twenty years, had his right arm badly out by running his bond through a pane of glass, in the vicinity of Pearl and Fifteenth atrects. There was a row at the time. Robert Brittonormi thirty-five years, had his right is t fractured. in consequence of the falling of a telegraphic poll at Eighteenth and Market streets. Stabbing Case.—On Saturday morning, Al derman Moore committed a follow, named Edward Conner, known at S3pruae•etreet wharf as neat - tor. in default of $l,OOO bail, to answer the charge of having committed a brutal assault and battery, with intent to kill, the complainant being Roger Cassidny Connor was drunk at the time he perpetrated tho murderous assault, and it is tacky for him that his knife did not do its work of death. Lost Children.—A flue Sunday always brings a largo number of lost children to the different ward station houses Thieveas the ease yesterday, when a great many little ones, attracted by the beautiful weather, strayed from their homes. Through the instrumentality of the municipal telegraph the you thfulwanderers were all restored, before evening, to their anxious friends. Narrow Escape.—A lad named Charles Mur phy fell into the Schuylkill yesterday afternoon at Coates.streot wharf, and was only saved from a watery grave by the prompt end noble efforts of Mr. Freeman, who, seeing his perilous situation, jumped into the water and rescued him as he was going down for the last time. accitlent.—On Saturday morning, a car riage, containing Mr. James Norriss and wife, while being driven through the Twenty-second ward, was upset. Mr. and Mrs. N. were thrown out and severely injured. The driver, it is said, wee intoxicated, hence the accident. lie was ar rested and looked up. Political.—The committee appointed to make arrangements for the Dem:matte celebra tion in Independence Square will meet this eve ning at the Independence Hotel. An orator and a pereon to road the Deolaration of Independence are to be selected. Deputy harbor Master.—We learn that Samuel 1 . -Curtis, Eeq., has been appointed by Mr. Petit as deputy harbor master of Philadel phia. Mayor Henry bile wisely determined to es tablish a reserve corps, and twenty mon have been detailed for that duty. The force is not to consist of more than thirty men. Sergeant Hen derson, of the Fifth ward, will have charge of the corps., There is nothing new to report In the Phila delphia Dry Goods market. The demand for woollen goods and heavy fabrics is limited, but prloes remain unchanged. Destructive Fire.—On Saturday afternoon, between 1 and 2 o'clock, a fire broke out in the roar of a frame house on the west side of Seventh street, a few doors above Shippen street The flames spread very rapidly, and eaveral of the !id joining houses Were semi. ois"fitiiiie adjoining houses were mostly fraiiiesiMad,the fire commu nicating to woodtdOrk, 'Churned with great rapiclity,'ood Rio ocetinOte of ceveral of the bitftdinge-,cere'oenipefted to ily fer:aheir lives, leaving itlttheir4feeis behind theml , sl, Th 6 property' destroyed badly. , dittnaged was : ' ; • At the_ nortliwkst corner' OUBlvenib and Ship pen strectswas a brick tavern, Onsupied by Pat rick Howley., This building was unroofed. The next building west of this was a small frame ocoupied as a shop and dwelling by Mrs. Margaret Boyle. The building and most of its contents were destroyed. Next above Mrs. Boyle's was'n frame structure, occupied by Patrick Makin, wbich was totally de stroyed. Nothing of' any account was saved from the wreck. The neat building; was a front's, occupied by Pe ter Nolan.. It was destroyed, together with most of Ps contents. Next came a three story brtok dwelling, occu pied by James Moroney. The upper part was de. strayed. • - , , AU the. property described above belonged to the:estate of James Welsh. It is believed that there was no insurance upon soy of it. On Seventh street the following property was Oonsinned : - Next above the corner of Sblppen was .a small frame which was occupied. by Mrs: Welsh. It was destroyed, and-but little of its contents was saved. - - - - . . - Neat above came two frames owned by Patrick Connor, and occupied in part by him. They were undergoing repairs at the time_the , fire .brtike out They wore completely wreaked, and most of-their contents wore destroyed. -They.were - occupied as Junk . shops... Mr.; Cogan - occupied ono - of .theso buildings. 'Above - these' Structures *sea small. frame,. whit - dr - Was destikyed. • Back :of this pro=. oerty a small frame was destroyed, and - twciamall„ brick dwellings - owned by Thomas Mclteever were badly damaged. The entire loss is not very heavy, as most of the property , was of little value. The loss falls heavily. upon these .who generally belong to every poor class of people. . ' LETTER: PltoM 1 0 W.W• TORR.- • : Nr. vr.Youx. June ifi;ifipth To-day is a dead hent,ineta,broeze stirring, and the leaflets as pendant"as the trelf-tiornis that swing lazily in their. shade. New York le quiet, for the newsboys dare not exercise their lungs, and the calorie is too powerful even for Dead-Rabbit or Short-Boy demonstritiOns. ,Of ,course, until the midsummer heath moderate, nothing definite will be attempted in politico ; but' when the contest sets In, we may expect a lively ono, for there was never a greedier set of expeetants ; never more bit-• ter recusants an I turn-coats ;-never more unserupu- lons ins, or wrathful onto, than Gotham presents at this - moment. The confirmation of Schell---=blason ed by bonfires, and blared by music as it has been nevertheless, far from furnishing Gllead'a balm for bruised bones or bosom's ; and though ten thousand crumb-waiters at the table of customs threw up their hats for " Gus," at the oeronade on Friday night, and denounced "Judas Haskins" as a traitor to Democracy and Leon:Tien, it is morally certain that there aro not ten thousand appointments in the custom-house to reward their chivalrio devotion. We may look; therefore, for equnlie, as heretofore. , , The recent notion of the Grand Lodge of Masons of New York, whereby a hnrmoninus basis of set tlement was agreed upon, does not meet the wishes of a "small faction " of the herder-headed broth ran, and we hear threats of a continnancn of the seceding body in some obscure way. It is to be hoped that the fraternity in Pennsylvania will regard the settlement adopted at the late grand communication as a final one, and be prepared to receive the regular brethren of this State as Ma sonic members in good standing. The order has too long suffered as- a body from the self-will of a few. The Cancemi trial closed yesterday by a verdict of guilty against the prisoner, much to the sur prise apparently of his counsel, Ashmead and litlankman. If Still another new trial be not moved, on the ground that Cancemi was tried by eleven, instead of twelve, jurymen, then the sen• tense of death must follow. The case is a curious one in all Its details, and most singular is the fact that a poor journeyman bookbinder, such as o.tneemi, should have interested influential sup porters and command largo sows of money for defence. It is surmised that he may be the head of some secret order of illuminati, or other revo— lutionary society, whose members sustain him to the death. He received the verdict yesterday with unmoved demeanor, merely inolining his head as if he expected the result. Pat Lally, who was reported to have threat ened one of the witnesses who testified against him with fixture vengeance, is out in this day's papers with a noto denying the charge, and asking a more charitable judgment from the public. Last evening a cool robbery was Committed, about five o'clock, opposite the Park, in Nassau street, a lady's ports-monnaie being snatched by. the thief in broad day and in front of a. store door: The robber was seized. and denied the not, though the ports-monnaie was found in his hand. He was walked off by an ununiformed officer, followed by a large crowd. The ceremony of "crowning" the blessed Vir gin, or rather a picture of the Madonna, took place to-day, at the Catholic Church, Hoboken. The picture was a gift of the late Duke of Genoa. It is a copy of Raphael. The crown was presented by the Duchess of Genoa. The Committee of Common Council have at last settled the method of removing President Mon roe's remains. The services of beta the Eighth and Seventh regiments have been accepted—the latter to pay their own expenses of travel, main tenance, to. The exhumation will take place on the 3d of July, on which day we, Gothamites, are expected to celebrate our national birth-day. The remains are to be conveyed, with escort, per steamer Jamestown, to Richmond, whore the an niversary will be celebrated on Monday, with ap propriate funeral services. Messrs. lfuyler &Put nam, metallic, buri 1-case makers, have offered, without charge, to furnish the metal coffin, and the committee have accepted the offer. By report of City Inspector this week, we find a mortality of three hundred and liftya decrease of fifty-ono as compared with the preceding week. The weather has been cool till yesterday. The table Is no follows for the week ending June 19: Men. Women. Bays. Girls.. Total. 70 74 103 103 350 A brutal murder was committed on Friday night, by an Irishman, named John Lyons, employed in a sugar-house, on his wife Bridget, by kicking her in the side. The murderer was arrested and coin mitted to the Toombs. The Vanderbilt, arrived bore yesterday morn ing, made the passage from Southampton in nine days, eighteen houra—the quickest trip ever yet made, by four hours. The shooting affray between the eccentric John Cooper Vail and a Mr. Ludlow, has resulted thus far in the commitment of the former, in default of - $1,500 bail. It appears that Vail suspected Ludlow of improper intimacy with his wife; chased and shot at him twice in the street, without effect, and then, when Ludlow turned and Bred back, in continently ran away. Vail is an unfortunate; but talented tallow, and ahead bays bad a better career than ho has bad. Yesterday Wall street was quite active, and operators wore very contented faces. In stooks considerable good feeling was manifested, and a fair amount of business done. The activity ex tended pretty generally through all kindsof relia ble securities. Reading advanced 1 per cent ; Delaware, Hudson and Pennsylvania, the same; New York Central and Michigan Southern (old) /. In Reading operations there is manifestly a dispo sition to control through the influence of a mo neyed clique. Whether the stork of this road can bo relied upon, in the ratio of its rise. is . for eau- Vous buyers to consider well. Worm securities yesterday advanced more than others. Preened stook Michigan Southern advanced 1/, and Galena and Chicago 2 per cent . ; LaCrosse and Milwaukee went up 3, (stock and land-grunt bond); Cleve land and Toledo 4; Brio crawled up I. At the second board the upward tendency continued, and at Its close rates were firm. But nothing is to be inferred front this little splurge that may index, the future. Transactions at the Clearing House, Saturday 19th Juno : Tot.l exchangee Total bale noes NEW YORE 6TOOII EXOUANON—Juss 10 SECOND BOARD. 13000 Wm,' 0 , 8 01, , ,; 500 N Y Con R 830 82 1000 Ohio We, 'GO 101 1100 do b3o 82 1 j 5000 Tenn 0 . 8. 'OO 03,V1100 do b 3 82% 5000 LCr & Ikillig bg 33 100 do e3O 82% 12 nkm lianover Ilk 0O 550 do 821 j 50 Am Each Bk 1.5 60 Second Ave 1115 90 CO Dal & Hod 01 Go 100 I 10 Rea RR 1110 17)i 112 La Ocoee & Mil R og 150 do 1% 60 do 630 614' 1(0 do 016 17 20 Pao Al 88 Oo a9O 75X 100 do 171 j 100 do s 3 76 50 Hod Alcor 11R 2 67 200 do alt 753 i Ito do 27 100 N Y Oen RR alO 82 25 do 610 '27 100 do 03 82 50 Ditch BhN Ia R 21N 250 do 82 ...; GO MB&N Ia p 630 43 100 do 630 82% 400 (lal &OhcRR sa 813; 100 do 113 823 100 do anw 84) TILE Id Flocs.—Otviug. undoubtedly, to the speculative ten dencies of the market, arising from ant Icipated scarcity at the South and West, the ncHvity of operations hies not diminished, though. OF on Friday, common grades ruled lower in price. Altogether a heaviness was mole apparent than the day before. Sales rising 10,000 bbls, including superfine State at $3.00423.95; extra State $4.1.06 , 4.15. In Wheat 55,000 bushels changed hands. Kentucky white won active at $1.33 ; Michigan white, $1.0701 10 ; red 11 inter Wentermsl.ola 1.03 i; Milwaukee club, 03e; prime Chicago spring, Sec ; damaged do, SOm See. Corn was dull, the prices asked being generally re fused. What besiness wan done was confined mainly to Western mixed grades, at Ole for damaged. 73c for good. One lot of the former 'nought 6Se. In Rye, the sales amounted to 3,000 bushels ; 71m71Ne. Oats 45e; sales of 10,000 bushels Chicago are noticed. PROVISION9.—The Pork market ruled dull. The WO were 300 bete, including mew. at $l6 95; prime $43 75 and $13.80. Beef is quiet. and no change of moment. Butter, Cheese, and Lard remain as before. Seates.—Accounts front the West Indica hive con tributed to preserve firmness in the market. Prices aro unchanged front our last quoiationa, and sales yes terday amounted to 1,200 hhda and 240 bbitl. COTTON remained steady. Sales measurably lively. For middlings and upwards rates ruled 12c. COFFEE.—The remainder of the cargo brought by the West Point went off yesterday- nt 10c. ' Altogether, about 2,300 bags Rio. 1,000 Leguayra, 200 Gonalves and Bt. Domingo were sold. WHISKEY.—Potr business—WO Ws at 23xe. Faelowrs.—To Liverpool the rates for grain were lowerart unfavorable indication. 60,000 to 70,000 bushele wheat went over In bulk at 4.Vd to 4, d. Flour Is 6d; cotton, 34d; cheese, in cabin, 25st tierce beef; Os Sour to Gasgow, Is, FINANCIAL. AND .COMMERCIAL. THE moNuy _ PHILAp:LPIIIA. June 10 MI. Transactions at the,Stock Board were-to a moderato;' - extent, and considerable firmness was maul/eat in the prices of every description:of shaies. The bears, who, for Home time back, litre managed to 'keep priest down, are:evidently timid, and evince no disposition to put out new eontracts. Those who are wise will take in their ehorts with as little delay as, pea ib'e. The bulls are gaining courage,‘:and" ere sanguine that a_ general appreciation of .steek valtma . w - 111,Epeedily.take. place Theie misery reason to anticipate a rise that will effort a rich .harreetstO those who hare Invested at depressed rates. The London correipontimit of ill - ,3 , C;minzeretril Ade vertiser, understood to be a gentleman intimately con neceed with the financial and trade interest of Great Britain, writes as follows on the recent Gulf difficulties ; "If no shipping d'eplaylug the emericao fag is to be visited. except at the peril of a war between Bnglaud and the United States, the - decision on this side as to the course to be pursued , Plll not involve a moment's consideration. • The almost universal remark is, that whatever may be the horrors of the slave trade, they.- would' not bear the 'slightest comparison with those which would arise from the hortilities offered-as the only . alternative ; and that as the duty of linPfxoteing It should be perrorrned on the international princi ples observed in the rasa of all other forms of pi racy, it would not only be Quixotic but wrong for Great Britain to continuo the task, exoapt with the general mopes -often of cholized Buttes. Ma net for Great Bri tain to dictate to the rent of the world op moral gam- Vons ; and if Bowels equally strong with herself, and equally entitled to entertain their own opioions, re fuse to agree that anv particular ease is - etch as to call for a general measure of police, it le'enongli for her to - have proposed what she considers right. She can harp no claim to. do more, and on responsi bility beyond. The hope, therefore, is that the whole 'subject will now be completely and finally. brought under review, that an nuderatanding wilt be come to whether any thoroughly efeeient plan of harmeniottettation will be - entertained or - tolerated, and that if true concert shonld be found impraeticable, All further measures on our aids may - be . at" once and wholly abandoned. Bach a remit would rave us half a million sterling peraimum- - ..set tree 'large number of ships and men, at preeeot eseAly.swanted • to. provide against three contingencies nearer home which aro certain to continua to threaten tut- so- long as oar In dian embarrassments exist-and .the_samer.time give nethe - prospeet of cheaper suPpliee of coutt-notogar, to bacco, rice, and all those articles for.whieh, as a na tiennofishopkeepers,''ne are millpond' eioluairely to feel concern." - • •-• PHILADELPLIIA STOCK‘BIOR NGN /filie 100858. -1 ' -' - RETORTED ST 'MATlEldiiqiitOTEN;'& ' •l7o'i '-'IIANYE-NOTE, 85006, AND &SCE Midi 17ROttitS; NORTISiTEST CORNED TIIIRD AND CRESTA UT STREETS. - - BOARD.'-_ - 1001 Penn We - 89 X 20 Reeding 11 2'2.% 900 do . . 89X 50 do 200 do 89% 60 do 224 1057 DO do 89% ' 85 wrkint.2lX About 190 d0..4nerf5..89 X 100' •do 92% 1000 N Penn R 6'5..e.57% - 50' , do' ' - 2.23( 2001 Sch N 6's *B2CA P. 5 7, - 200 - Soh Nay pfd 1500 SCh N I‘eptrs.2d.6o 90 do .... .4.:.14 2000. Passengsr R 7' 13 ..84 200 do , - cash . ..l4 21iforris Can pfd. 100 30 Penn B -41 X 20 'do —lO9 4 'do ' 41X do —lOO 5 Girard lank' 10% .100 Reading R.... e..22X - 10 lienharifes , Bank"..2BX AFTER BOARD. 2500 Penn s's 89%1 20 Locust 310antain.,22 3 000 'do 85,141 50 Girard Bank 10% 1000 111 P. I's Ist r0rt..65 • 20 ' 'do 11 3000 N - Penn li O's • 57% 10 do 11 1000 Pseeenger R 7'13..84 20 -do 11 8000 Tennessee s's .:.7431, 111 do 11 50 Reeding 14.-.35wn.29% 100 do ..55..11X 44 Penn R' - -413 BAT] 50 Reading R 2 2. if CLOSING PRI - " hid. Askect O States 8a ) 68.-114- .. Mkt We 98 96% - do R D 8 96% do N0w..300X191,X Peausylv 6s 609 90 R 1 , 41 ' v 2 x' 22% de 1 ' , 701u0i114 X 75 - do Ds 44..90 ... do rot 6e '88..68% 1 9 Penraß -4..41% 41%, do Ist rat Ce.loux.. do 211 u 5a in oir 88X 87 X 111 trio Caul Con. e 145 do prof 300 1103 Sohn NB3 82 57 5734 PHIL ADELPIIIA MARKSTS. /one 10, Evening I.lreadstuffs remain imietive. 'There is some little de- - mitutfir Flour, but at a prieebeloii the views of hold- - eve, and the sales ate confined to the wants of the home trade. it from $1 26 to $4 . 50 fot common to good super fine, $4 8 llies4 87% for extra. and ssla6 76 qp. lAA for extra family and fancy broadaxe In quality Some frr ther small sales of Rye Flour have been made at $3 313( 41 , bbl Corn Meal is quiet at $3.8734 ifc bbrfer Pinn sylvanla Meal. There is not much inquiry -for Wheat,. and only some 800 to 000 bus. good red found buyers at 103m105c, and white at 11001200 but the demand is limited. 1440 Is wanted at 88c. Corn is steady, and - further sales of about 8,010 bus yellow are reported, mostly Penn at 73c elitist, tacit:ding some moan lots in store, at 7fes72c. Oats continue in demand, and about 808 bus Peunsylvarila brought 420, and Data were 41e: Bark—There is no demand for Quertiltron, and petitions are nearly coming!. Cotton-1 ha mar ket is firm but qu'et. buyers only taking hold to supply their immediate wants at pravious quotations. Groceries —The market Is tine bat quiet, at previous quoted:lone ; a few small oak a of Sugar bare o one undercut notice fay former rates Provisions—There is rather inure nquiry, but the sales ace mostly iu a email way, it 11 sal2e for plain and (Ivey Mine. 93 for Sides, and To for ,Shoulders. Green Meats rare quict, witlCiales of then'. dere In salt at 03ic Lad l e . trm at 11Se.for bbls, and . 12%c for kegs. Wirekey is scarce, with a small bush bees doing at 23a:3 for Pennsylvania and Ohio bbls, 220 for hhde, and 210214 c for drudge. Markets by Telegraph CB notsioN J u n 11.9 —Cotton—Sales to-day of 1,000 biles at 11 it 12340. Tbo saleable stock on hand Is small Sloane. June 18.—Cotton—Sales of SOO bales today at 11X all is for middlings The sates of the week amount to 2.1.,00 bales, and the receipts to 1,700 The receipts aimed of last year at this part. amount to 32,000• The stock in port is estimatod at43,cou tales. Fre•ghts on cotton to Liverpool 11-32 c NBW - ORLRANd, Juno 10.—rhe cotton market in un. changed 2,000 bales sold to day, Pales C the week Receipts Receipts ahead of last year at this port.__ _ The stock In poi t is estimated at 131,000. Begat , is quiet at e %ale. Tobacco . :steady. the other mark , is are generally unchanged. CIEARLESTON, June 19.—Flour to 130011:1111. 'Whiskey dull' at WM; Bacon hes declined X and la dull. Lard is offered at 10c, Mout buyers. Mess Pork Is offered free'y at 611.60, end at that rate there are more sellers than buyers. The money market is dell, and the enmity is abun dant at 6 to 10 per cent. THE COURTS. A TUILDAY PHOCEIDIX4O [Deported for The Press.] Noss PRlM—Judge Woodward—Buckley vs. The Union Canat Company. Judge Woodward dolivored a lengthy opinion in this ease, refusing the injunotion to restrain the defendants from ap- plying the rent, issue, and profits of the Canal Company in certain coupon bonds of the said com pany, alleged to have been paid on the istNOcem ber, 1856. and the let May, 1857, of any part of the debts of said company, until after the pay moot of the coupons which woro held by the cam. plainants, which fell due in November, 1857, and May, 1858. ' Messrs G. W. 'Biddle, V. L. Bradford, and G. M: Wharton, for complainants; St. G. T. Camp. bell, Meredith, and Hall, for respondents. The Girard Pastenzer Railway Company vs. James Page, Robert Morris, and others. An ap plication for a special injtmetion to restrain tho defendants from usurping the name and authority of commissioners under the not of April, 1858, and from continuing to publish certain advertisements, or from meeting to open books for the sale of the stock of said oompany, on the 4th, 22d, and 284 of JUDO, IDS/. Upon this application the court made the fol lowing order: On condition that the plaintiffs furnish to de fendants a certified list of the officers elected by them, and on giving approved security in 52,000, special injunction awarded according to prayer of bill, it being understood- that the commissioners are to adjobrn the taking of subscriptions until litigation ended " Theodore Cuyler, list., for the complainants; Meisrs. Campbell, Gilpin, and Clay for the defen dants. Joseph Droworrs. The Second and Third•stroete Passenger Railway. Compsny. An application for a speoinl injunction to restrain the defendants from refusing to take and receive the rum of $13,000 in payment of the subscription for 2 600 811141"09 of the stook of the said company - Con tinued until next Saturday. Messrs. William L. first, and Wilson, for the company; Joseph P. Loughead, Eoq for the respondent. UNITED STATES DISTRICT COURT—Judge Cad walader.—The United States vs Lucius Swartz and John Y. Castor. -An argument for a new trial. On Saturday morning 'Messrs. Dougherty and' Rankin Argued the motion fora new trial, reasons for which had been tiled during the week. The arguments of those gentlemen were very elaborate and forcible . They were followed by the United States District Attorney, J. C. Yen • dyke, F. u., in reply. Judge Cadwainder in a brief decision refused the motion as to Swartz, and granted a now trial to Castor. QuAnrEtt Sus:don—Judges Thompson and Lud low.---The court, on Saturday morning. delivered an opinion on the motion to arrest the judgment in the case of Aldermen Williams. convioted of mis demeanor in refusing bail in the ease of Fletcher Webster, and not permitting the examination of the witness in his presence. The court arrested the judgment, owing to a defeat in the bill of in. dietment. The bill id this case was drawn by pri tate counsel. $15,071 423 68 888,842.50 COMMON PLEAS--Judges Thompson and Ludlow. —Judge Thompson amounted the refusal of the court to grout ohartors to certain building asso ciations, or what claim to ho such. Tbo judge said that there was nothing in the form of charter, as presonted in any one of them, showing that the solo object was the improvement of buildings, or t enable the stockholders to possess themselves of a homestead. In some of them the object, the judge said. is not stated ; is others it is declared to be the safe and steady investment of the funds of tho association, as well as the improvement of buildings. Under such a charter, the court said, the oafs and speedy investment of the funds of the association, in mort gages or any other securities, would be all. pro. bably, that would be cared for or thought of. If those desiring the charters saw proper to amend thorn, so as to conform to the act of Assembly, they would be granted. Between nine and ten o'clock, yesterday morn - ing, an alarm of fire was caused by the burning of the roof and upper story of the residence of Mr. Courade, real estate agent, in Seventh street, below Barclay. The damage was princi pally by . water. A few minutes after two o'clock, yesterday af ternoon, fire woe discovered in the establishment of Mr. Samuel Jackson, pyrotechnist, at Tenth and Reed streets, adjoining the debtor's apart ment of the Moyamensing Prison. Some powder exploded, and did considerable injury to the building. The origin of the fire has not been Mandy amertained. There was a large atten dance of the fire department, and the flames were prevented, from further extension. The loss, which is estimated at about $3OO, is covered by insurance. Yellow Fever.—The barque Charles E. Lex has been detained at the Lararttto on account of the yellow favor being on beef& The captain and ono of the crew were down with it and removed to the Quarantine Hospital: Both arenow considered ont of danger. Vessels in Port.L--There wore In port yes .terdny three - steninshipi,' Bye ships, fourteen b2rques, tweutyAvo brigs, and thirty-one school. PM. 50 Reading II OES.-STEADY Bid Asked. ...it'll Nay Imp 69 ..594 tic 14 do n00k.... T.. 8 -do _p of 133 :43( iew.sp't Nr.103 } , . 703( 11),X do Vs bit ni6.34 X 33 do 2d mt.. 49 tO (.tea; Maud .... 11X 11X. IGlrard Bank 10X 11X Leh Coal & Nay-..411X 49 N Puma 8....". 9X 9g • do We 67X 38 New Creak Ce.wiroo. B 8)4 7 Lehigh Zino X AC 31,500 6tol .91,000
Significant historical Pennsylvania newspapers