Carlisle herald and expositor. (Carlisle, Pa.) 1837-1845, September 24, 1845, Image 2
~~ ',kII4TTY,,_EpITOR_AND F'AVARIEIOII. • A tOLIS w hiiijd v ti a t r iith i to * L .( '" -II: ilfibittiiNAL' 0 OMAiipSii*Elt :::/' aol ,J 4-1 ME l ':JlGhteebts*k 2rit , ; • •:. , I:;:aateinbly; Hainoden.!: JACOB) FOOOMON,ORR Elopew ell. ' !" - '• . To talk Ao :the ;•Whigs,ef :Otiniberlabd . "40SETil1" IRWME; ounkrabout the necessity of placing, autih " • in the board of canal. commissioners ; - fioOld.be to intimate, that •the,l'are.lincrtim-, .le of perceiving., : o self-evident truth. 'The Recorder: RO WlLsOri • Mechanicsburg "' -• ' tA , Regi,f/(er , • JACOII I)REI'Zi Carlisle. , • • • Dire'ctor of the-Poor 1 Carlisle. - ' - JACOB RIiNEA, S. •.' Treasurer: • Thti - . "Qinaig . CaThe.l4looNpf theWh WO for the ‘ moh,e; s of- - onr - Partytnnr - county Ond onr. Stater Everythingfkor =aoth lug ' ia'-neCesaarily absent trothlown, which will'aecount for any it 1'4044 or errors' in paper. ibt..We Call . the attention cif 'Mundane to 'he - itliettiiiiimetii of .Stevenson di Me '; ill anoilier colenin-tll6'ishave every. instrunienis 'pm] 'ill of 'the niost OEM _ 8y t ieglect of ...`aesitsrp - Cni'the #losloS i t . ' ja_st; aboet as irtaliy . votes last fall -*esti)have. 'stitriCeilto carry' the • ! This is afcat. have 'a like larrietititiori •- , votei assessed teh days bqfore the at this)'ea~l ' p~:n " order : that every may...pive l tits name placed on the Hit WR ,notice that l our friend, gr. , A. G.tx.nrtEAT#Xop,is.announeeti as aninde pendeni candiditte for the ,House of Dele etes,,,in, carrell, county, Md. Although , an, indep,endent candylati3 he mane. to sink or, swim •enly.aa Whig,, and with ,charac cristic koldnesil, • and frankness states in defittitig bis.position-"In general ptillcy I ant, a„Vbigrrbetng in laver of, a Tariff.for ~,revertue_and p,rotectionot_sound-uational c_urrertsy s , :. the ; tltrihutto,n,of,tho proceeds of the public lands, and as to the annexa -00,1 Of etate that:l ,tae op= pused ri tit,lt,but nciw.actluiesce, as a mar j9r#Y:l4-POPP4llba!fkliecid94 in ,favor. aryp ydr3et„genefuett ,aud aq4;10!)IP - ikin9,00.4Prfoupdr; sod we shall chronicle hie, electien,,witb . ,„ !.pr ,!: - .:11?.(1/ , :!' tai .... .., , 1,..A,1MA.81ERP41 4 1,1101( .11143,, Rumw.r.-The, September number of this admirable month ly'ie - on our-iableomd-is fully equal to any t , of. lts 'predecitistireitrz'iArtielihif : * Wilt ) with, , , Mexito. , ..ExeCtitivel:Us'urpation=Ettra et ~finm:the !"Journal , of! uliflialif Iliiiiii; 7 -,-17-by-4wßoislllromtai.4-Naiiontil:lnstifute;by; ~ 1 4ore',Li R. Ingersoll-'?•Trahelation!,front ••:14he Gorman 4 iis RinetWinel Song.; i2The, cit:Ptiqmitfotolike.Fstlea, i.YanilYPfNinities l D b•Y ,3 It SlFY.eutiFia A Ihenciry.;• antic Resources ; . illifaMaitutiiby , Itsv.a.C . V: Alpha's l'fh.,, atbrifiTiit4ilita andaltelltootrine of iltittiOr l , ~440,5 „ i; ; 4 v ta ik i t ib oil i B4(l4:_iinit AUdublin t 11:by o,6eeleshWinuifielilvTlur StiituatY; by, , EliWilliam : aWallsatitil'sederieltheLGreit ; . Stanzas ; pOo's Tales Relicon lul' Hok ----- VialWry --- -i- - v- - L-ttedisrfi'LiteraT,T - No- - ' ' i iiiii." littieriVa n iabioliii4 - Ne‘ -,- A r titt f aiii !- Abliiificia4,6Wilitioin: : '-' . ,- ::1 .3 )i , tit, , ophqt,r" '" "" '1""*1 1 T " ' j'''''i '- 1 - - 0 : 1 -OXIIVItiffillitrthilitittitel ~ 1 '“'llriOlhtifikgfellgliTidlfakiiitiliiie riitpi " :6 4ifilifWeViiirigiebVittilit ihi l tiiiiliti Visit) - L billlsit i liVitieSislortitiii tiiimliti.Ooillie . . . . .itieticiifliftiiictiellpilidlitiiiril"andite*; ' , triliqitaiel chill 4 Wee tiristiritil bi'llir , I 14• -filufriatilf trinas *it ttid . Widi; tutuir itO: `Clidtiltlr "c'ittreiogib Liietiv6Anitt iiiatlie iori; -44 1*** * .itisiily,Yotilfeh . s #diettiiitetiiiiiii,e , "tioilklititteatidiluili iffeilhitiglAigfieoflit'ii i : - Nteo6 l- 4441Brhifri - tlffiti - Alitalliti: - : 1 •' '''Llliotze 0 0 1.404 ' .. ""i u Ri0g.. 1 4 " 4 I .'" l ' d -- .. -- k 7 lkkitiii i r Ttirk' tribiiie -01 Yo'it* : - ' llll-- NtutPlarroir4Wii ll6- is the'; 1111 0 :. +SI. 7 'itgiff:i l ekilfiiiiiWritAiaellWtigorge ` 'l *rwititi t iihii d ookk:* 6 46% 4N fti iiicatieviiiiif if**tiliiiiiiil664ililf, , 11 40;:gigOi i iiiiiiiifOtirtliiii(tiiniii j Ailitgi* lial ' Oiiiiiiiiio4loliloo6 44,144* 4111111VVIASttAft* ---0,-11it0 , .44,4.,,,.,;. .440,,iiimido, : 41, ,ii.i.,'..L.: ). , .:,ogitoog, - ,-,,,,,,-. 4 -2.1 i 1k4,11411,,,J1A,- , I. 45040011,0. tr :,!. ..-410 ~ ..,, ., t , ' , , ~ . , OtOrtkrt* 0 , ;_,:,,,,,. - 4 .6, - ,:::1a5,`,14 , - 4 ~. : ~ itai,4oPf,Til.;,, , 1 4 hrsnanmorel.li - miorable.tand honest then .Sastus.r. KARNS breathes the • sir 'of Pennsylvania.` `His =abilities - to perform the' duties of the office creditably detar of Act, eltaturLacofocoistn dime : jut:;kuesilini:,,ne.thas been employed On ;he ribWW3ilailorPolltr/Otori.Colleuthrii and" recently asiap,tain: of .a, Tooke t. k; aa... o „,,,trecome fatquainted ,with , etteryl of. Ca nate; and haspide himself familiar withal! the diities, belonging to , thi. office of Canal. Colnrolir ,He i hes, been .11.,witnesa, of :the mieethble policy ivhich has charicterized the manigemenyoL works for years past and knows how to. correctit. Atidigatn rasto7ofliwitetlPle t woroteruPon: our public int provements,-Oflatelrears,'and the incompetency and,diahonesty of those who, have, had them In oharge, have been ficiglaring as to flare even upon.the.stuPid perceptions of those of our political oppo nents who are most easily and willingly dupeA by party . chicanery. Our 'efforts to have the public ,works sold have hitherto bur unavailing ,"and so lon!they..-remairLin-the-hands-,of. the glib, -shat ..:ommcknwealth, we ought to strii , ll..tt. they be intrusted to the care of o,llicial.a• - gents - who - wiirsee'that they - be properly conducted , . The election of. Samuel D. Karns,if it do not wholly, abolish, wilt at least check mismaniement, by the_nriajoi . : ity of the board. Can we, elect him T• We can if -we will,--AfuKboto is all ilia necessary. Our vote for Canal COmrois aloner at, the. late election'..was upwards of one hundred and fifty Thousand. Leas than this- nuniberbasEthis yearfor our cab: dilate will elect.l4im,. QU r friertdsthrough out the. State Will4Wkwake up; and instead ' of slumbering at their petits under the sub- . pcsitiori that success is imposiible, set ddigentlrio work; ,they, can secure•the electiou-of Samuel -D. Karns. ) ,Let the :Whigs of Cumberland , county rally in their strength .on the day of ,the election, th4wbether defeat or victory- f 01... low, itribe State, they pay-- be able to bout . of having : done, their ,dotyd-77 The ,late . Geological Survey:„ln . New York, catahllshed, the,fact that coal.cannet Oet fountiAn . shat:StMe4., iwcomputed, on sound cla!hority.,:that,half, a million of sdol -101, were fortner)y squandered in useless researches for coal,, in The .valley of the Hudson alone. PRIVATE POLITICAL HISTORY.—The Y. Tribune sayst Vre . hairti en intimation on wfiieh we can rely. that,' during the last . Preahlential canvaes, a few days after James K. Polk hail` 'written his Kane-Tariff letter for • Penney lvaniawhich exerted so' vital an influence 'upon thb vote of That State, he became—alarmetileseit-should-alieniate-th 'ree Traders, find despatched atlpttier het. ter to' 'Kane; iiking Win tk return or sup press-the Tariff lUtte'r. But meantime the letter, either had heen pOblisked.by gal i , or thuj,oeu, minsgers of P i tinnsylranis,found :thhtuseiTes aO,ksid: i presseil;on i t ) lip Tarifj! ,argumeut,,tlist,•-ift:ey-yieMt4have ; leoutoit 'all' iliittleniMig;' their eandidatii '4r.31,k 'to iti;i4 that the MUSi have something from Pdik faimublUl to Prgtect ' ion, of ` ~he Stale was gone:' SI) Kane put 'Oth, Palk's letter; - and - siheri' iequisition , • ,;; , ;:• ;,ra,,h ~•;,, came` or: its retue • ).• 4711 1 . 0 ' nat,or *ottltiot suppress ,u. _ WIII Mr Fan' gobd form js an ~ l er~os of fact ; end W in'ihe ‘tstedtehihbovu I ''•lf MdikOlids' the PUblii'vtill ktil4"hoiti'i'o'interpiit if. 1.) , 'I; , • • ME 1111:74Three lthous inii• five Ji u ndrilitopqa.v tivee.larceipp)oyodlio l the gigantic•knoppol. live leBMibljellißent Yfi.P,( 1 11111Y! put for they 1i0nt1.9909f, 1 44 Old large MuMbeKl°f .1 0 P9R0T91 , ::951!1irP4-roi! OP great c ha ilAA!.(PqrQ, ll o`o!F!! 1 41 Pao .POrqr , R)1 1 1 4 41 hap! 49,!: 1 0 if 3 ,97 a4 §truPtOr.Maig YV ,l4 o l o ,, aoPc"itoniaPt,Pe 2 lItB 9 -40 1 ,g-POlPleert 414.4 t 4 ,1,4 irraTlin"Alniandrial3niette it no, aArninedinc,;,lAZih`Qa, that-064:e • ppTippet, a n , rant, - jtandet nprrense, ie.to be or ii put io fo;l=tinni totl bty .disgraced , a !Pfrgil'ilu,?°77,!!!!runirTill in p!npfira tn„cc .t ltpepen'_ . contain ./ wki r p 0opr,11!" T thing liar tfii:id tional''good s onic be iri6 . JiCe la furth" " e:Y190 g 8cg r A404451824 Y 0 1 19 .1 ) ?Z: 4 4 0 kk. , k!.I , ACP II IOYt c:= 4*-1 44 091 ? MAP:CAPV;O.O(fI?'' 1 4"t 1 4 1 7e4lifieri f9 , 0 0 1:4 r,d , t4Cth*,+ 11 J l ,llO . fliegremiNiuiF:sPlTlPAPliice ibiliWTT4l4 xq ‘A4v,i,lsl-3 :: c' '4O gliity' 141040, tabilt • dd *411;0. $ lici':Weltiiir 4i; lit'WeiiiiiCelii4a , rt,,ltl i lin n r t i w ir y a vt a a ti . tkawitgip t i; orltneirT„ tk,air4"-, --,-,k,,e ,', J ii Atille , i;Rrep ec ,it 0t 0, ,,. jx. ~,,ovl k ntrfdell. II ket"-k&--it , !Mi ell • 1 - 1 - I f at . V- 14 1 - 1 /f _.-etiVtofir Aet-Prittligt ir fie i l-P,P, 11,1110 tiken i fer b i il k l y e‘ f a a. 1 it , .Ai Jt , -,' , gi9l:9 ; g!put , ; • , •,, : ,, - ;„1 - ,.•,1.0) ..,t4 1,01 , !:,, , ,,iii v , , , i 1it ,, 1 1 1iiki1t4.04 4. 00tik4.),01 0 0,0, 1 1100' , ili*Ori• e , 14:4"4,' '!, is _ 0 0 410 00 1 ,4 1, 4 4#4 4 oiib 1, .',:,- , • ~ R, ,, ' - '' l '. Jr ~ ,, , 4, 5 , a , . ..14 ,11.': i t :'''' , 44' l 4§'.4 2 4t' . -':: 4 , ' , ,':-,,,? 4 1f., .., k0 in' the selection Which Tn.-medi c liave had an.reye-in-ihe .napibiliti; Of 414 ~,,, ~„tferet!', e ! PIP,e - s ;0, / , bbiNtOri tl ik, 8, a f ter it del i .oi. - au rd - , g ea -,40;;, : bi - olif to I . , Itior hi 13 -i *entray.44ol4 14117F1i , ii,...g4,R,0,,,, A._ofiYitilitin_county,asaLeamliAte for the office of Canal Oommiiseioner,lit Oa e,neulng election., Illr: Karns butt •geT : , Alatifaii'df. etlitaitioni'ffilinitiiiretillitiliiiis .habitsrind , hllBl.llitherougkknoielleOge'-of pur`,._,Publid 3.170rki lk*he B lo l ,kstetk; tenaiyelrstml-favorabli known - throughout the State as a nutu,Ortitffilattibihedlslitirair4. Yri'Plicl , lvhoseltkietinteglitsrile tt. , :sore , i gparanti,4!Nfaith(nliditiCharge Of ,the du ties of the.offiue, should. btf receive, the ittf7 S fr nt”fili . , ( CP,oo7ll .- , 1 7.77 - 1 7 :, 7;7 , 17 '* h eY ul o-OP,OI, I I9CTOO.BY,Iv.aniRt. - thplit' 4' which 3 FP. B , P 0 001 11 9 .. (14 in theAllnilltAlliPtf f - thii - Ciiisliraiialtailriiiii il, ie nag,ebout SW - M - 0,000 l.„ The InternstOn thin_thibt to 'O,OO - 0`.6.6 . i ' lVliile i the;inOiiiiii from ilie Nidi'e *Orki;:aftei#,liiiVitiii:i(h;iss' and eifielilrOs;Vaiii,etheat, cn4phci4*ne,. foliktit h er r thiilaiereei,)i3atihig . .#!;pplo:96o to he ti annneilyeole i cted.k99 th1,3,p41n1 _lt isbe4iteii \ that i t!nd4r a propkv / syetorrtiof 'manageineitt--ffie . ffieitiyirsatO,fao arorylof idle; Oltri'ilitliti:agenta—a'striet'''o r !ceiiut 7 ', abilitineall'iiiiiOursing44 accounting fi en r i e t rs.' tr -'-an . 4 4 • adoption Pi',lf u liberal and 'ghnad tariffi`,,Of-Itoll s-stiats-secur,- ' on our atm"f ine the l f o . the est,. which now pasSessover rival routes, , will , greatikinerealethirexenue from our Works, The New York canals, which_ connects; the-talcie 4- vith - tide , iviter;,arirdortia_ well located asare trieeit i ol'Penneylrania;which, connect the Great Ytilley . pf the, Cfhlo With the sea board.' - -;klfir-imigtit liiiir twit of-' ford a tonnage Coiliparird"Witli the rich ,pro';• f ductions - Of mite FOrriener iLE r ei. and Coal „ , Yet ' --,-4 1 . 1 , 4 g Mid Ciial mines. the New Yorl canols'latit year yielded $2,446,314 . , and a net profit of over-$2,000;000 I equal_ to the . interoet on our entire 'debt; while our Public Works, which are mare eitenelve andlietter located;' did not yield a net rev enue exceeding One-fourth of that, amount. All,thie is •owing toted management: To reform_abuses—to: introduce econo rbi—and to adopt such a system of mills as 'shall awaken '-enterpriie :and, bribg, tradeand business' upon our Canals and Railways, ,:k1 Kinivs is prevenjed, €lB oandidate: He is a candidate:of the whip . party, and is pledged tirt : eqry out its p•in•: , ciples. Let- the Whigs throughout the COniinonWc4ilth rally once again in atip l , port Of thair thenkshoW 'thit 'undivided :11;but next, they 'Will never yield thairOtianliation or their prin ciples; but that, { like the victorious Whigs Cie,l776.'gnif lEl4o„l.ilitillyi IVA° ii--them , r, selvae'woCthy of yi&t6is , ,•aii, - ;11)14 'cause is . woriity of-euccesit. - • JOHM REED • TAMES HANN A'.' Gto. M'MAHAIsT, —'- JOHN'S:RICHARDS, . GEO. W. HAMEIISLY, , THOS. G. APCULLOH, - U, V. PENNIPACKER, OASSAT, I WILLIAM' STEWARD. JOHN BLANCHARD, THOS. STRUTHERS, -• THOS. FLISILT4 • ROBERT SMITH, • ENRY H ' NRY PEFOVR, • Whig State Conitilittie. Harrisburg, Siptoniber'ls,lB4s. Tpx Cool ockost...—.-The,eostof was has been exhibited er — iaiiitly, and all its evil arms upon ;the , morals of society been ably.depinted. • But thefcostiof :be-found , •not-less-enormouscand-itseffects . as destrtieti,ve, to the, morals end , peace of the. comniunity.,l , llcooniing•ctolhe , -HOn. .0. F. Butler, rum andJits eoniequenceireri;_ a yeerly.lose,to, the Stele,of New Yorkl of "eighteen millioes:-.of.dolleri,n and bailie, United States 'of 'hundreiVan4 , ..filif , 1 millions of ,dollars:', 4 . This amount of r7ireelth, 'annually wasted ,would cieui to educate every. child the: Pn"it&iiiitie's, , spit t rel eve;mgs of tile , dub 41 1 ,5.4 0 (c al r e Al' 'fl, lB ! ° !' t u i 9 . !k , 'PMcl 4 , lt Yr i. , tf: 13 tin tee ifie it t stated in n a lifieiliOni7W r ti6iiititil,' ' l t4iviiihCiViiii'iiii4teler . oii6C4iid tialForiiiceion;heahas been 'it times snbjeei concussion he '' 0114490, is j it3p, 4 1(!.0 or, , nombor oflpdloo of ,diedlled'liquiniii ,dielilled oOnoelly. o .is 414,503.607, which l ir , ,eold'aA,Rl) ; epos per,gel,lgoef would:produce , 1W,QQ9,090; :414.0i 0 0 1 );; , otfilocrre.isfs 9 111 11 0 1? f 8 40,4 11 401 6 0,1 kaftOriPlii , . 1094,0 0 ' dFigi-IPT4o4llo:*,PtillifiC.44llll,oM-4.OYr , ts=ll/ZeTheolconneben , lournid, snOttiiihiii' the potitoe rotov Mph Jou. two, 'for , Alio' icing has hetaiiitillintiitittiVe in the middle' Sliten:nlid liediint iiii'Miiiiiiiiihtellii; iiilf end lo " l6imi iuttoni iniiiivr llaiiiptitiiitilinid lifilA4 - iiiifiiiilifillnlie - Oill'rthielyniir's y ti tcerlDietv 'England; bilvit'fictitisiiiiidNir g rk i nii ikkai k ....lit' o".' it.lt LV . = - V 1 I):.'ei ii)li f' 7.7 - ; Ay: o , t ,^ • .1 , ~, jr:lis - 1 . (Idol, 'Snip To 414 'A iiLiiiT4ii —, t la:. ~1 1, 4 !MS Ift, "1-g1'.14/, 1.1141';.7 i,i - tit...7. Ut4COVe7 . glICU!S01 1 3 , Op . .numgate , li fin t '''iiiiiiiiiiig ‘lialliiien; ) innlW'iiiti iiieiVa i kr,i 7 . V 'iiii i fi Vt'aSilipiiiiiiiti4 b i ligiiiiiikailiit'ils e t liel iflierat4a*ifliqiii*AiSiileilitPaiiitt Our Pliviiianf's fam)liit ,iiiii *046: Joirico*rom,o6 - 01 - eivirethbfiu'd*q_ 4 ~,,,:. 4414 . , Y4 lti Ntrrrool4 74 r . " l ":, ' ) ..;1\• • ' il 'l t ~' • '7 llll oofaoPrfing: 09404 1 1;i 1841 $* - "OA. ilgbtrok4r-Itripill drobtiesii, be ligatif - ,P jolhe WOlitii,N ; Otlfii. piwirtk; ,11 Pre . - 7 it i TkiievOiiiiiiii gieliteetrinsit4 ••„!Tfitt %, i° in th° 1 ,° 0 ° ,00 0 ion In;In 3 ,0!1 i .- „tiv, ) 1 . , i ll!, 1 - 7-f— I :: . t , ,-1 ( v 4 in°°lo.tioll ticket; an4aiti eitleilyio_fat as regards ~Messrs. Brys on, Wilson and Irvine who aro perionally v known-bere.- r _ i Midi° fat it lhe Tallarsblers and :wittlifida4 ' 4one:o'A other' nominees •are--knowni. 1 15' 1 °Jim, i a l a ?.. 1 1 111 ° 0 3 9 1 0.f. 1 9/ o ) : rh°W iioket.. siaiiitiiaii we intend tO-givo a good . account of whig prinolp,lo!l below; ate, cidgi,c i p: 4 4 q .a id ida i l ltieed it y,,Cf,iftp to b an ,, .4 1, `ii-;iini br4Orn inlinl , olhor-.Po!iii 9f, irie o.i,k6'ilil meet nsiti'lliti Sadie, ;spirit, alid - come - ttrarthoworli - rrianfullyTwe - Ca carry out - tioketi,by amajority thatviii riot 'only Ositifouinitcrini enemies bdt'ssionish 1fi .4 17* -151 6 15 0r001t0.0.17A. Ittl#o,O r sarvie l nolop l ,barmony atida ,fu'll turn out: in tho .loiveteiiire , go - for:carrying out the Will:of tha'peinildse . e*pieemed at tile ballothccrll4 . fali'lnr,iiffeildi . ee :,toi the sale , of the i'ohlic. Worlie; ~Fitir:Olten in thii townsliiiii , : , ;whete , q the -DemOotiek holi' always'beeiOrikrimbant;.. lighelias begin], ro,daivih. 110 the majorities here fofore - v 10 41 014 wlbO.' 4 rOrY, nnikrodOSodt . -' , 1,, ,-i -• + ;oltsTr9NlAlt Dolton/4T, Orlon. ess' •e glad tollearithat-_our. ros 'cots for tueeess Aare ibecomieg, trighter ,, every.. , ! hourr-in, this, section , of.' the-, county t the , wounds , are-becomlng,healed"_end , ,pespe again 're stoqd in.otir circle—we are cep. taiu of success; and itbecornes each of us(as tpronfiii, to,do) to larour shoulder to the wheel, and, give, push,ftlard push,. and a pleb - altogether. The Locos are 'being frightenedreod-ntany: of-titem7are - silently morkinglgainet_their-own_pariy.- .Let us teke heed frotn'th,js,- anikmake- the . victory to me - as - bright :ail 'passible. We can (16 it if w,e,try. Yours-in haste, , Wl-11G. Shippensburg, Sept. aci. 1845.- Tut. TExAs WAttrlie Itlashington Utiittiti While it disavows' the autharitY of Gen: Gaines to call ourthe militia, admits that the President has 'atithorized Gen. Taylor , to ealLon'tfieGoverncir - of' Louisi- Qua, 'Mitisissippi and one .or two other elates fot aid; ..Bow happens it that Texas otitributesAnitliing of men or:. means to thin *et,t_ , -It is. her4etekmarr.viaged•lot ;iterovre,"irerpoites..The bodir 2 of the Amer_ icon .People have no Teal interest in it. - -- - Irthen,..euziegtdatermy. o .‘now mainly .or dered,ktexas,. ie insufficient to carry, on 1 tlie,*EtivWhy are not lhe-Texians,required to do something?: . Why do not ihervol iinteer.toolefend their- homes,..if they are It!silinfitV:-i7rWitere-ttre.theltereei of San 4acin, and the, Alamo. . 1 - Flijii. e - ewer; ,weepprehend, is that the %that. ,fi .Is.e.humbug for the;..bene- N ti fit, o( coMra, tore. and speculators. , Vast sums. are 'needlessly expended in despatch: ing - 1/.. S. trdops,end Louisiana volunteers to distant,fields, where there are no ene• mios to_eneounter. _The story_ of-the. Me xican Army . tarns . out to be of . the same complexion, as ,the pid Indian rumors in }he' Florida.war. Thrio,o6o men, said to be within SdaysYtnarch of Gen., Taylor, are as hard,,to find .as Were the Seniinoles. ' jtjlite‘ Chic?' Conference of, the: M. E. Chltich is now in session in Cincinnati, is ap- lamtine-press • ft -Thursday -Week, Bit;hoii • ivlia adheres to •the. 'Methodiist l Episcopit Church 'South, was invited tt takith'S'Chtiii: The Conference was not - 'willing 'l6rectig • nfi,e'' poi its Oresiding;offlOr, apii c aiioj)t' a retuiqition bY'ari L itiniOtii'inutiliinoue.. vote; expressing M"""%texpedient arid 'highly improper" for Bishb who hivenePainted thinnaelvea ' of ''the 'Methodist E l Pian'oPttf ' 'preside ' , in any; Con .ferciii'co''4niPorsing'ettid Chit. Ch. ii THR ;EPHRATA ramset . tnezetT.-i- This geestepneent eptetnenceil'ori Tueeday;' , the /6ti ieet;;_and:bitike up op , Friday laet.— pie, Au other of ci zene - fa a ttettdance wait !err new:Few pa..Thureday, , ai. the layiq ProPle iPPYPAPPLone Of i.the,lAlottuatentl=-: , „ :4 0 ,reePnIRPTIT, ,0();4 1 14, flith - VPo44';,,whiehuncosektil cplno l 9Fl-QCl.lo44elp,hierdeliveml in et -101.9.4 15./10r,efus,,c1 CALmeEL,...,One bikes in 3 Philadelphia soldwitilitetlitiliieffikkeryeem . l7,oopibe. ortlitlOMei, and 'A! iftiotieition . l ie two titiqiiiellt diiilleil ititt',lnthi 'Pei: annum` by ihe'citikeitiererithiintedielne.' ''Siiee'iiiii M ihii - timiTtiiiir - tit ike'iltkitnittniliiiitil , : l 't 1 1 0 - POkt,ia.4o4 l 4l l ).niftP.• soya the' ,figeheeter Demperet, icejled,a ; me ting '' , P, lit l 4o l l IP .,ll ,VPP o .oieiAlltP , Alt ,, Pley:' .‘4;r1,..;', 1 9.rfigi 1 , 1 , Pei 5f19.30Y,11 1 41 iNlt,.lfig,3' 1 . 1.7 , !!i tt irkf 1 ., , ,P 0 , 1 Nc°!,0, ) 9; 1 404igt°,101 ,- , iftWiIIIT!,!P!„I , MT,O,!,?.., I 9I I IOOr4A)P . - 31 4.41,1 e -. tqli n t li i i lo l 4 ° PVl TiriMPPt.i4Clin , Tl,l9ll.l,4!rsinif'?h,!ci'Mliu!PA4PO'kr the l'ogkero , -1 7b• IdlifPgtf?p. mob gaY,9 1.,,,,1iki 0s .?;14 4 )fflp ! , 9. 1 ,1149 : 1 1-9, 4 1 ~ A mvA, 4,0 p JP,l, , P4icill';ll4 l . . 1 11 6 091MP1 , '•fit 6, 444' Alf eAye,pTs, , er. 1:„, , ~,:, , !, ,, ,ii. o,f . . ....r:, y f , • -I *P.The_ telliginß---,ot'fiDanktoiinKyki bivgatteettle be. moved ilibbiaemeterplot ,thet oily, the captains-Of the Mooed:ROL -, Rof,ltk'fionkst:°•l,4!o. - .,,, 7 ,1 1 4;, --,,- 7,4. - ,14T - twitif hl;ttr,l7-,°4 l lMT!,;ihflir.c.,94 ,kiititli ,grrlK WfiMIPItkIY,?IttAVAPPAd 1:TIM/Pilr?r,t PO it? PAlD !l'.. e l r . 1ta;17,4 , MI. ' ' . 4 . ' , :t "f 144"F110414!0iti,FM.1.11,A*1140,4"14P4D -41kP'illoarili&k!Nii#R1011.90tqlsolet 10 0 i i i,i1- 401/ ; 1"1# -I *Ni 914 ,4' ,6 ! . .1 1 fi. 0 1 4P#4 01 0 4 0 8 4*.d!O e n gi Ogi, r bieril 4 'A' Xff. i .* * !? lo o l4 ,o4 e rniOniu*! ( ol,ol/ 1 00.7 1 4 i#Ml4 o WSoo o44l o o" lllnifi i ~4 ` 1 1001 4$ 010.0#4 . 4 40 "044 , 1 0 0 il.*.iii - i;?i,kiiiiii::4 , ,. - 41y:y4out;; 4 1,i4i ~,,., 4.3,:t.,:;,•Aiii,;.;;-t-4.-iii....0-2 Eteki* ` : RAnniit,, ill r E.' Ci" Dl= tillooo, of :4Entiotfol?iklinlil his pocket NSA ioktilloipg'sitiOnt siiik thousantaol ---- II • -,- 4 1.- t ~,--, 71 bre, 'n t ftinnAnotilibs( *kat on Friday niOCi ill ' Baldthote at. die 110111 lay kn:eet •Thiinrei bi iOino oiiirciieiiAlipocket. '" - if friction lilatchoe are ;rubbed upon , a co,rk,irt ,ttangt,,,t!olit"iicF t "Rtitio fit:el!.!,.. , _Thia, simple direptionAti wortit batwing Ili mind: • ili Alitii/E 11) , • • at mr ou pt N. mo r ti; !kth houie; f ulu i nin7°° " n n•;* !!',D 14 1- , ,„ 8 the ilon. Of t YghtPri, ° " Pa. Newtown;!mucks yowl y, SOn the Tlat me RODEN. 8. - . lt6tiitet4rl,. to Mien of South dioton. .7 t• ' ; ..In• Harrisburg, on Sunday' ingining lait, the 'grei int:ifter a lingeiini Mid' intense ly: painful , •dineee, Mrs,•'ELEANOR' P.S consort' of ,W: 'P.' Btaprii, Esq. and mother of the editor of •thie paper, In die 70th , year • of her (age---driginally. of .Meiliernitneyaciuceattray, aid latnl Columbia,' pa. ..The deceased was truly "a.irtother inlerael."7 - Ir - orre mirrinife she gave herrheart , to . . -the Saviour, and up 'to the clone of her lOodlifi it_ ii.believetl' she :over-continued-to grow in grate-and in the •kniiwiedge Him, whom. to know aright is Life eternal. She . was a consis tent, 'active and nsefill member of , church and of society ; and in the Jyar—snd dear Relations,of-a-Wife - Tufdlii"other those who tuourdler:loss know - how faithfully and ionarly she 'perfirard - every duty She inet death.with great calmness and resig nation, in 'the fullaiikurance faith, and io ilia ftlifinptfahl hope of a glorious iin mortality_with fife_rideemed.- PUBLIC , SALE. • BB lY . viittie`of a dectee of the Court of Common 131 Pleas of Cumberland foamy, twill expose to public sale on the premises in Westpennsboeo' township, to said county, on Saturday" the 18th of October pt 11 o'clock, A. Mr • A first rate limestone farm. situate on the Big , Spring ,boundid by lands OfJimes 'Fulton, Samuel Treat; James Piper, and the BigSpring,.contai ning 1133 _.ACPRE, • a tar& part, of w hich . is in a-tugh..state of:cultivation im atheiestdue to.fice timber. , There_rs an excel-. lent datelling.Honie and barn on the premises,and out houses,-making - it one of the most"deeirsible . farms in the county. - . • •Itwill he sold subject to the life estate, of James Montgomery & Wifc ISt the survivors of them in tiDoussand, tot coopthiingitbout one acre which , fornw . part or the farm—and sutOectlo the pay ment of $BO annually to the said James Mont. gomery & wife and also as mach grain as will be necceasary fore their housebidd purposes and feed fbr one cow and ebb their fire-wood. Thi, terms of the sale Will be five per inept of7-ttteTporelitildi mOney to be_ paid on the conrfimation dans sale Ookresidue of one half_to_bo _paid _ of . AprlllEl46 and the balance in - three annual pay: manta the wholote besecureLiby bond and Mort., gage; - Sheriff% Office, . ADAM LONGSDORPF. Sept, 24,1545. - • • Sheriff. • READY MADE CLOTIIIN mHE G E936:3 l 2oll l 2DaftealtelaCiKEL'Ute snbaeriber has now on head one of the -most eitensive - and beautifedassortreents of Ready made clothing ever offered for aale in the Philadelphia market. The garments are alt cut in .the_most.fashionable_ manner, and for-iork. manahip and •• quality of material cannot Weer pasted. . CO liriE ,ONE COME . AM! - . , To_ M. Trace r y's old Painter Line, 292 Merkel St where you will be sure of getting great bargains, as he is determined not to be undersold by any onto competitors. He buys and sells altogether for CASH, consequently he can ,sell greate:-bar. gains-than-t hoss -- whorbuycerciredi M. TRACEY, . . . 292 Market Street. Philadelphia, Sept. 24, 1845. • - MCOMPIELY .EL&OAZDIEFAI. VAT recei4ed 31..Kneedleea Cheap Book eV and Periodical store. ' • COuvrib l o:sssga,klno: for October. 25 cents. Graluinies 'do = „. do- .• _25 "- - Godefs Lady's Book; do ' 25 Artlture htitgazins. 7 „, . dolBl N0t10n41:...,7110. ' •.. • 181 4 . Also a large assortment'of new novels and oth. er viorks. , .„ • Sept. 24, 1845. • • '• It , *alto tCZEglkeetcon tantly on handiilaiiiindsfbcuke used in the Public and ,PriTate schools; and is determined to thcui,al )elp prioo than: they can be bought atat.elbor, establishMent, in Carliale.motwith. standing one of the booksellers sending notices 10." , eifeh of - the. teachers In Carlisle; to be read publicly In the schnels. , that,he would - mill the . books-at-a -lest... Oleo than . t h ey can .be tiooght. elsewhere. - Those' - hinnies' who .bought: - .booke luniw. full well that he.. sells theme .least 25,p0r cent lest, litin',they emit!! I.bouglit and t hat be firstwhO redeem, Fleet of boolielo Carlisle. /045. - • ; PLVTA . EI • Attornettit Law. .p s lo CO • the'sevcra tate of, .t e Cit y it 'Oj'' t e . imd county .of ,phikdriohis, - • - !be Stiles is et Nit. 35 Soutli FOURTH street.' 'between Chestnut , end Wslp tstreets. Pbiladelptlie,Sept. 24, 1 4 Estate Of ICtib!aa Shireinan,'deceatid: OT is ,hereby given that ;letters or Ad. 11„ministration,qn the estate of Tobias Shire. man, late, irt i Alleur township. decertied. here been iiintd'in Oiiin Of law to the subscriber.. All. p_ersdnirl iidebilid in said 'estate will please make. immediate '."payment; and those; hating claims; ,therriAnly_ anthenticated for settle. milit i flis the auMeriber at Shiremanstown. - • , - DANIEL ODIREIMAt tJept;: . , - OS , A a , Ira to '. l 4 :4 ls tl! **r ; a i lit std a rl`" elvefoq d ". [ 4lhe/rs: .V ~ , -,a :,;, ~-atevinison 4.ljoiefitalg).4l-_ 4 s • "-an, "Irup,tz, ~.Ap.ssleti'keek:cindi'inesYriip to . r . colds;, !tiity!lrcie!yeg and for -ned,,a,t the cheap, itteheireif • • , , Lamr'',.,otts,] ~.sper t al ; tim Ind hil 4 o 0014:kit*: filioys Pfrifl TP4 .!or **Act hefficint 4psott.l .o ~" ; )(.4 el I ?i Stevenson*, zehritrey, SINUS'S' Mat IMOACCO ' fliA rtaAraerioi*jairted 4iegir4 atid aro?' waNta Csiventlish abaisco bot fitocitttL dt , 1 1:),A. 4 144111 1 .244- 1 0Ve ‘, • ‘.''t ,1 0110 °? 1 ;7 1 r 4 f 1 ,51UM 4 "' 9 - ' • P. ; '4o 4l rialo-. 2 ,O k mixe l t, 4 1.-41 *A esb,Vl4Kilt4l ,, V , 41 , 0 c golvons.,:::,: iircelvedrie.lS 1 EDT.Eft'S ohsi Batitekanct:roiliidiopt,sgeore; ICTSAVORKS eight*ohlakeiletourileiiitaiigkig*fge-4- --,-,=-,-..- ,Ipblicisoptiy 9 f l•Fuilire 840401600 m Vi . 003 Aititir; PhifouViy of ',Religion, IMprivemenf. o Society, Moral, ImprOwimestik.EsSak an cove-. ouittess, Celestial kidenery, 2)dereal - Heaven's', a tha very low price of $2 75. Also, Dunlap'. Book of Forma, containing more than sir limalred• of the moat, approved -precedents : for eknveyart. clog ~ , tit tkeloirY low P rloo° F 0 .! . " 1 4. 111 !9 - • z". :,:-- ;,: 4. atigerntior '24;1045'. ': ,•, ' ' .. - . '' CAHIPISTIINGS, 0114 CLOTHS; &is At 0') f‘Cliettp_Store,°!_4l Strawberry. Skeet; PhiladelphAd. - , WE would call theattentind of nervous in . Wimp ..;,-VzPor.,.neweiniett,lte;l to' the Wet;ol'ollifbeing `enabled, to, sell .gocids atlerr low prtees, because, Nottr , ntesettesittiatton current led other ; kxperise;. ; °re fiery light, and we offer. for, this '.season an eV Mlllentemortmetinf,t - 7 4 7.. • Ingram atid!,7 V everryy variety ,. ettetlia,,lif e0.,1 7 OiL% • CIPTH .341frfa..2 . -4.14101- and howth rugst, rOdi, eile . "or - re4allftkethe Mweet prices.;'• ' supplynfthe low Triad carpets ; itaitrorn SE to 50 cents pei;yard, *68 , 44 on hand. , - - • ELDRIDItir. :DROTHEIL " • N 0.41 Strawberry, Street; one door Ochre Pbesnuti c•tfear Seeniid streeti'Philadelphla. , September '24, 11345. 7 ,3M:c. ! !! ••... . . , , ." -: . - -: -.. 151%:13 1 cEic't3(211.E1ac . :, ' . • •' + : ': .."" 1 .1,-.' ' •"',' i t4; 141 IrN the case of the'petill • ist Satneslifolieehan to i'lhe Eh:Wirt arcomnion- ' Vf'Climbeilitini coun ty in the State Of•Penniail Ala, fora rule to Show' causti,Wl4 sk:conlinissioneeshould!hot bwappointed to tale the 'testimony-of witnesseirmin perpetuam rei saemorian,". hi reference to. the •title to a : tract , of lab% shalt te•in Welt Pennsborimgh township, in. .' • 'tiliti.itilit.Slateafor4taidrbouralitilty-landactf &Mittel McKeehati.,,Rev, liobert McGailireth.lemes VeCullatlgli; Jacolx;;Sites' and others, containing • ittrutit — mie -- 1411red and seventy:Slg acres • which said tractorland amadevised byJames McKeehan, 1 sr. deceased, by a certain - paper w_ritiftg_pajm_fti .._ ing to be the lest will and testam ent of said one. dent, and the, title. to which ,the aforesaid -.lititica 'McKeehan the petWolter avehi - Was vatted in him at thetime and before the execution of the aforesaid 1 paper writing • purpertitig. to be tlm_last will and testament of the • stioresatdeliiies McKeehan, sr. deceased. - 2 • ... , • And now, to wit I's 191.11 Auguit, 1845, the Court - grant - a - rulextrettlfilte ,parties ifirereatehl to wit : Sarinfel :VlcKeehan,JantiesMeClure,JOS..Mcelure; Mary 'McClure; NanerMiClure, Jane McClure and Ann McClure, children of Margaret - McClure) deceated,JohiclUctieeltsin and ElizabelliMnKee han his wife, Henry Adatris and .Mary Adams his wife; Men oh James Reed, William Reed,.Samuel Reed,John Reed,-and-John Creigh:-and Sarah his Vile, late Sarah Reed, children of William and Nancy Reed, the said Natter beittg_now' deceased. Alec:, on the following named minor children of. She aforesaid - William- anti Nanny Reed; by their tither and next friend ,the aforesaid William Reed, to wit: Aleiander Reed, Genrge Reed, Richard J. Used, Margaret Reed, and Nancy Wed ,to appear at.a Court of Common pleas to be held at Carlittlit in anti for istid't oUntrand State; on, the ninth day of December, Anno Domini, 8845, antral:ow cause, if anyAltey have, or-know why a commission shall not issue tinder the seal Of the Court to such per son or, perions at the bona shall appoint for 'the examination of witnesses "in perpetuam ref mem prisiin7 toy the prooi of the matters aforesaid. . ... . - • 11._ -.BY THE COUR T . STATE OF PENNSYLVANIA/ : . -• ' CI:MAI:ALAND -C,OUNTY, 11/1:.. , - .- - 1,- Thomas H. Criswell, Prothon tary, of the' . Dourt of Common Pleas of said oonn- - . iy',4l6;ttertify that ihe foregoing. is a - 1 ! ' .) " true clipror the orighoilpetition and j ..,_ ' ,-- )( i v pi:nee:lava had therein as full and 1 ' 4„, I. :entire as the 'saine remains of record,' 4 ' in Shia office. . - , „, . . - Given under my- hand and thmeal of said Conti at.X.Jarltsle, the .twenty-Mth day of August, Anno Domini, one thousand eight hundred and forty-five. For Tawas 11. Cal immix, Prothonotary. JOHN MAIN. . . .September IT, 1845. .._ -TO- COLLECTORS- AND -TAX.-PAYERS 1 /FRE recent payment of the State nix A. the Coi er nmtssioninf cOniberland eouniy, out the funds the .Comity Treasury, renders ifneeesiary to require totaled in 4 o..,itiprompisay 7 . ntent , Ofthe Snowing county` tletes'io enable the Commiiatoners to Meet the current county expeti-: setii and the. payments becoming due . under the contract for the erection of die Court -,'llottae: Under the provisions of the Act of 49th April, 1544, if the State tax of any county be not paid to ih e State Treasurer before the 24 Tuesday in Jan eary-inesteb year, the .defieleney is required to be pall out deny money in the County ltreasuq,and any State tax remaining unpaid by any helipilual or corporation after said tax Is payable by die &flinty to tbe Commlinwealth, shall bear an interest Cf 3 lnx Pita CENT., and be a lien on the estate on solsickit is charged 4 till fully paid and satisfied.- . From th e foregoingit will be seen that, although the:State tax has beewpaid to the State Treasurer, every , Mx payer who does not pay the Collector before. the 13511 of Jabutiry next, must be charged six per cent. interest thereon till paid, which inter est every Collector must Cpkulate and collect - from each hultvtdual named in his duplicate wh. does of pay his_ tax - prior-to-that. date, and saliTtrta together with the interest' thereon, is made a lien on the real estate of the payer. It is therefore luiped tharevery Collector and tax . payer will see the importance and necessity of paying the whole tax charged in the duplicates, prior to the ISM of,lattuary next, to avoid the trou ble and inconvenience of calculating and collecting interest on every individual tax, which must be done it not'collected before that date.. • • - , ROBERT. ILA IRO, • . CHRISTIAN TITZEG ; • WORTHINGTON,. • Cominissiimers_o'Lemxibetlind.eMr CoMmissieneep O ffi ce, Carlisle,? l" •' • •, • September 1711s;;84,5. S •• ORPHANS) couRT SACE BY virtue of an order of the Orphans' Court 'of Cumberland aunty, will be aposed to public sale, on the premises,,on TUESDAVine geth day of Octobet , next, at I o'clock, P. M., the folliwiing described real: estate, to wits _ A Fird Rata Limestone „Farm situate in West Pennabnfough townaldp, Cumber- Iswil county, 'idom si miles south of Newville, one half mile east of the head ef the Big Spring, and midways between Carlisle and Shippensburg, on the. Harrisburg Turnpike Road. bounded by lands of J. Myers, ‘Villitim McCune, John Snavely% heirs, and others, containing. near Ono Hundred and Seventy-two Acre', of firal rate Limestone, Land, of which about lairacres are•cleared,lenced and in a high late of cultivation, T, ,he tat roviments are, a largeTWO , , 'STORY , DRICKIe STONE HOUSE, with a back building attached, and is at RN present, and always has been, occupied- as a Tavern Stand. A large, HANK BARN, with Wagon shed, stage stable, corn'crib, wash homie, bake and smoke honse,grannaty,straw houiet. ,00mplete cider press, cistern and never 'Silting well of water convenient to' the door. An excellent apple orchard and other fruit treea: Thu terms of sale will be. $lOO to be paid on die confirmetion of the ale. One half of .the residue purchase motiej to be paid on the I st 91,Aprit next, when possession will be given,•and the remainder, itivro equal annual instalments, without, interen, the ptiyhtent3 to belief:ired by recognisant:es with seal rity n the Orphans' Court. Grain in the ground and rent to , be reserved. , Due attendance will be glven on thelley of ale, by I • JOSEPH MoDEILMOND; JACOB. MYERs. t • Adnilnietrators of Peter Duck, deed. September 17;1645.-0. j; 4 crThelanniatafer Examiner and Vollariond will insert till inde;sind forestal billt this offt.ie for ' , ll3*sildilag:•.,:o 0 ~,• t`- , ''';'''''irliiiiaListi'Shit'i' -- ' :::. •!, cPaiatiPtilier, Executor O'lliOn34o,Tria?, v. ~,lbilw,gol:id9cealted,,voll sell ill t public ', mile; be s 5 progiiisesi In 'the, town , cif Newburf,,Hopit well townehip:Ounibetland:eonnlYi - on-TuesdOi ,, $ the POI ' daytor , Oetaber next, the ; fellewin TOW:, ntsroOndto wit I , ' Eleven Joe eituite.eiatt , '6 i InclitiE4coond itivett.: , Tycp offjho m , , hi t * , l In.teelleit eininie'or , Wiattiir. - Alitie-trietil, OA, Ai, In:MArkfr f ttelt. and 9.1 0 , 164 an , tloaritr.kt i i i i,t i 044V. 41 '4 1 10,:.' 'Milt .°P, the :' 4 144 trtriltr,: . .1 q4 „, ; - :rpiesi): lots Arsl weg..04,1 1 4, ':O4 At, ._ shown, by Mi. , WilAiikAW . ",,„....tWrt i , , 7 * 7,7 :3orio viatr:l6oll, :OP . ! snk!"" - t 441 ' . 0 - A • itio •da i when due 441 . 0010thenoe Ate •‘' f> , , 4 , :cohd tions =ma d' liti P ilin "'l ri P 4°.:4l***4 4 l A ' Sibt• ElRli l !: Al • 'llYsolt)i i ,bYl.k 4 e . , l *P!,ll lo - ' l a ~ . P.' , ! i , ~..=, .li ~,,',-,-:•---,, iiiiiiollti • tlf• '•- .: ... ' , 4-----.- , A i I ÷,..,:tii.Assw.rr,„tf..;,-.,rr: „ , r.,, , . ,, 4164-I,.„,..:stei v olin-i44410,44.. ,_. 014.L.,..f..0_!1.....m_1.4.4,4,04,0t4.4,...,,,,, 411 4- , g . :iril `.mvitlort;4o , ' - , (194ki . m. ~-.lstixig-1 ~ :.zt04.?,1,, ,,, 1, . .y.:‘i, . •:, - . ',..,:,,,4.4,-,:,,.,!=, ..',MtpliCZTiA.D2BZPlClA rWitotesale—Hou.s.ekg / t ~,i _r,A? ‘i - - • sro gdilllT.gx MERCHANTS:, ' ' ilikiiiidersighed illar . chants, Miiiitifitaiti. reit', Importers and Wholesale o , DettleFii lif- - a t city Of . Philadelphia, eM m brade the ediudt.of the,nakitrappr Press ot „trial:ram:lion al =until., r j e to giya you t a ho streets mtnumbera of our oatme al sotabilidififelits, and" rekiebtfully to invite you. to ars'eautinitittion of our rallAndMititer,ilooke, - W 11411 5. ilOw full' Ind Miiiiidekt. ' the superitir excellence and great'variety of our. (min oily .liputrifitedoren t in- addition , to full supplies tif_Fore gh i t 4 4 Doinostla Goodtofiiimy desejnitilmr *high *till litiold-od tkirink and at Pr.LnenAlil.inkitamintii fail-tnAnnirk"iatiniool97 preaent-theittomitiat induiententricipurisbasam „ ',. ~ -. -;_," $ '' -' i '' e' ' ' . lA.' o,f Ati . ....1 4 :; 4ihitritkkethingtoii-Noi-80;111arket— street, belOtr Thiiiti Itnpaitars and' Dollars in. Silk and FattOrtill 000dm, and finearoneh and British. cloths, ciesitikiaa and.tmatings.- ~....L.Laidley,-Spry 44- 0.-ice,' sireati importeit-and-Dealere-hi fiteplei Silk tind Panay Dry' Goode. Also, Idritishi, Froucin and American cloths, Cassimers,tieitinga and tailors' • Antes M. kennedy 4.. Co. 114 Market - street t Damao* and Foreign Dry Goods, lham:-Getaae 4.- ,0 8 Front street, . bOlow Chemin; importers of Merman gd o d a , and Pnialitisors 'of all kinds of slipping Solis. 13rothers, Ea A rph street between 2a nd 3d streets ; Importers and manufecturers of &ROY flirs, 'lnd fur caps; and purchasers of all kinds of ehipgiiti fnii. ~ ~ • - • • Alieitetel "FreicY, 292 ilarket etiiet; Manufacturer and'Crealet in reack4lothing every .gra a; , . . . Johtt Iro'dgeii_ll,inaof-teL bfammiqh - shirt collar, LIT North: second tartlet; Menefee. turer shirts, collais and bosoms; „ ---- nittOMktir - Bruosoft, 591VIntket street:" Importert-and -dealers , in foreign and dosncatio_ liar,dwarc and ciitlary.. . - MorsiB,:_Tdoker4llforiis, Pascal - Ron Works, warehouse S E center thirtlandWilnut streets; Welded wrought iron tubes for' locomo tive, marine - and othnr ballot flues. and all steam purposes. z . • . ', . N. N. jatorence,. .4gent. Nn. 3 Minor Immo; Agency fer the sale'of Southworth menu. fkaturing company ' s superi or Writing papers n..; Dickson 4-• .., • Co:. - E.- E.. corner Market and _Third,. streets; - John •C. Farr, 112 Chesnut at; 414 , W. L. - Ward,. 106 Ches. -nut street, opposite Sanders:eon's Frankliwillouse; Iniportera of Jewelry, wafehea, fine cutlery, Brit annia, Mated and silver wares. ' 1?. - 4.. W. Wagon, S W corner Fifth and Cherry street; Manufacturers of silver ware, and dealers in plated and 'Britannia Wares, for household use. . • - t Hall, Boardman 45. C0.,..164 M. Third - street, below Race; Manufacturers of 'Britannia, hlocir. tin,and ;pewter ware. . Also, deniers in platei sprions,.cutiery,.&c. Edward jones; corner of George an swanwink sweats; beiween Walnut and Cheanu wastiof Sixtli•Jlanufaeturer.oUsilvcr-and,brii-=-,----;. stair rods anicornice'poleti.; .-. .4. F. Ott Jilonrose, 16 South •Fourth' - street, between Market and Chesnut; Importer of toys, fancy ,and staple gouda, beads, brushes and „. pertontery.. • a .4hrenfeldt 4' Co., No. 16 N Fourth etreet v betwean Market and Areh, (upstairs;) Im. porters of toys, ancy and staple goode,-perfume. ries. musical instruments, glass, earthenware, - chinaware,: 4e.. R. 4; G.. 8. Irriet, No. 23 S Fourth - strait; Importers' of Paris and London fancy ar...„,' tieleichrushos,'-perfurnery, combs,soaps, statimi. - my, and. artielee for druggiat's saes. -.- Ades- Ilatrel; ,46- Sputh Third street r Importer,'.and:manu&etarer•Of pertuitTery, cos lilies; fancy soaps f -and dealer in faney,goods. , HduntriliSsiotoctOn; 65 North Thitill7f.; -, oPpOsitelhe City. Hotel ; Cblea,Quoiensware and •glofit r z :i • • • • - . • ilk 4, inson 4. .Armstrong, 88 Arch•st. ; • above th, south side; Dentists and inanufactu• revs of incorruptible teeth; plete. piot, molar and gum teeth; gold and tin 0.41; gold; plating, and silver plate and wire, &c. .111r4Ilister 45- - Co., 48 Chesnut street e • Gold, silver and' steel. spectacles. mathematical - , instruments, walking canes, -microscopes, and. spy glasses. _ , . . - Wetherill 4' Brother, 66 North Front street; Manufacturers of white We'd and other A paints, and uC chemicals. &c., end- - dealers-in drugs, medicines, dye stuffs, oils. &c. - • ' . Cam bell 4- &Truk; North West cattier_ eat 1 an 'Millet streets; Importers studdcalere in drugs, dye stuffs, oils, eheenitals, plate glees, &e. and agents for pure white lead and:Jersey window glass. . Haskell, Mcrrick . 4. Co. , f 5 N.-F ront at; Dr. D. Jayne.. B.S.Thirdst-neneMsrbet; Importers and ,dealers in drugs, medittitieti e dyce stairs, paints, oils, &c.. . . i l Pr . 4-John , -.R. - -Rottt diidi-GilldArniV-1. -01 , -- 1 6ce and drag. store,2B N FweennOlr Cenßuliihr :ptiojeitair,:druggist'..sti&ehiniiisfOintVprePrier e e ofnEtlitillict*lTniiiiiiied Tonic Mixttirii, &Q. ' ' ... . William .4. Proien,-66 Market Street' ,•• 'Sleeper „.$) Penner. 128 Markttfei4lontly aide, one door beta* ffouith 'street i , ManUfactim ' era of ,umbrellas, nrapola,_ parasoiettesi and. son , shades:- •' '' .. . ':. • .. . •. —. . (Oliver Evans, 16 •Cite,enut,str9e,t; Fire ' and thief prtiot ohrsts„...relligerators. wetei.,'dool ers;filteisrlettiffeepitrefev.ainif.ydetii-T'. ' • ' k r evridecire abnye,Market ;. Venetian blinti man. /1 '6 tietiiier -- - , : ' . • -. 'Finley 4•• Co.,' El •E cor. 2d '42 •Wolnutst. • Hartle,' 4. Knight;' . 14§"SCUlth: Piet - intl . :et. .5 doors above Spruce; Minitaistereraenit,dierers-- ~ iiciiiati'ariiii,"bedding and; feat** ''' "i - . , - E 'Periitig,'.loB.K.)lteonut street:B' doors corner offithilDfal r la Coicoico , s , i2olhorrisno-- Fortes. . . -,,,, ' ... ~.- ii :T,'-:: • -' -', 4 - k, lii - a h . 4,' , glliertDa IleW 86 . - Mirket. B 4 . 111inutaettikers':, , of fit com - oh ''and 'fent!' .'otoips ; .. mould and • digpeit candles ikti:.'" '.• ' ' ' . . , ,`:;R.Barton 50,0isinut street.. Importer of. Frenebsettfietaillooters,,Weattoro,straw.brsid.- ' ' arid fancy boinetswko..„ and ;bonnet-14'040.6m , • tted:crotrps. ~,,. ::.',i•. ,I, z ;;;*:: ! ':-. 7 . , ~1, , ~,,, ,'. , " Nefdles,4. Watson, , ISt Nnylh below' Aroh;;Manufactinerii of. sieves; riddleal scqena, and wire work in general.. : ; 4 01/400 Co., 263 Market;at; fide ;'oil alid leacher:, Rani l F'; Nriasier, SouthliVil lc; linpOrrelo,or Orangea.lemona•ratiiiniNfliiNC enrranla,"oloionda.ind,Otlier!`oradot!r: , ::,f. • facturer of lira engine; of ! 4 .- 111 /nn u r nwn 'lrilr)9%; .- ranted n all respacle4:,.\*,;•::•: , .. - : , .. 'ECk:O 7 4 4 „, o "i* `Co.;:,UniOn Aidge,Raia;,Fireklid.!r± tßq o Astrect!.;"'Maybpiv, and innininn.i ,benalioa • l 'OO 140c # 1e Y''''t ' F i e.h '' Ind Noorth7'Thii4,`, 3 ,lll o lo!; - '-'7 'OktiAt4wir:a Arel; 81 ,04 1 044*Cldillkllnd • in all It** 51 brjonlOrnolhoo. li. la,. edar.waie:'olodkMrbuket,,mat.,blick. log, Eastern 'lade woode n , tw a r • l ,A goi 3:teaiiethiOdijim •rer!_ 4 4 l C,‘A,_„ Bl ab4htoPP. l ,.•..r ,; Robert 'Folmer, 1,82 . ..11tilith%Settovie throb -docile -rnslow„,-1-,wlOf.,o,lde t. Idiom _ ItY.4iP : :414tid ;',V iti r i # 17 k# 0 4;i 4 00 0 stit.lt; 40 1 1)hidn' t 2A„ oft t„oiiit J , 4 ) * . 1i:•114,!411•4.. 44 4 10,, . F , 1 1 , 4 1 Orr "-. 4541 C 1 -4 4 : 14 • %In u o,p, KOK - , 't - 43 af:#o4t,tl,-YPrf EMM